|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WHR) |
Sites (0, 0)| (no "Site" information available for 1WHR) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WHR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WHR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WHR) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (6, 6)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:124 aligned with R3HD2_HUMAN | Q9Y2K5 from UniProtKB/Swiss-Prot Length:976 Alignment length:154 147 157 167 177 187 197 207 217 227 237 247 257 267 277 287 R3HD2_HUMAN 138 LSRDSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILKRDDASMDRDDNQTGQNGYLNDIRLSKEAFSSSS 291 SCOP domains d1whra_ A: R3H domain protein KIAA1002 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------R3H-1whrA01 A:162-215 -------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------R3H PDB: A:155-218 UniProt: 169-232 SUZ PDB: A:219-248 UniProt: 233-310 PROSITE Transcript 1 (1) 1.7 ---------------------------------------------Exon 1.10b PDB: A:173-220 UniProt: 187-234 ------------------------------------Exon 1.13 ---------- Transcript 1 (1) Transcript 1 (2) ---Exon 1.8 UniProt: 141-167 ------------------------------------------------------------------Exon 1.11a PDB: A:220-244 ----------Exon 1.14 Transcript 1 (2) Transcript 1 (3) -----------------------------Exon 1.9 -------------------------------------------------------------------------------------------------------- Transcript 1 (3) 1whr A 126 GSSGSSG--TDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILS-------------G---------------PSSG 249 |133 143 153 163 173 183 193 203 213 223 233 243| - | - -| 132 | 244 245 246 133
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WHR) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (R3HD2_HUMAN | Q9Y2K5)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|