Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE PDZ DOMAIN OF RGS3
 
Authors :  T. Nakanishi, N. Nemoto, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  28 May 04  (Deposition) - 28 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Regulator Of G-Protein Signaling, Pdz Domain, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Nakanishi, N. Nemoto, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structure Of The Pdz Domain Of Rgs3
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - REGULATOR OF G-PROTEIN SIGNALING 3
    ChainsA
    EngineeredYES
    Expression System PlasmidP030714-81
    Expression System Vector TypePLASMID
    FragmentPDZ DOMAIN
    GeneRIKEN CDNA 4930506N09
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymRGS3

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WHD)

(-) Sites  (0, 0)

(no "Site" information available for 1WHD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1WHD)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Ser A:36 -Pro A:37

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WHD)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PDZPS50106 PDZ domain profile.RGS3_MOUSE18-95  1A:18-94

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.13aENSMUST0000008452113aENSMUSE00000798656chr4:62280554-62280821268RGS3_MOUSE1-18181A:2-18 (gaps)18
1.15cENSMUST0000008452115cENSMUSE00000451224chr4:62284879-6228496082RGS3_MOUSE19-46281A:19-4628
1.16bENSMUST0000008452116bENSMUSE00000451215chr4:62286131-62286236106RGS3_MOUSE46-81361A:46-8136
1.17ENSMUST0000008452117ENSMUSE00000451201chr4:62286776-62287127352RGS3_MOUSE81-1981181A:81-100 (gaps)25
1.18ENSMUST0000008452118ENSMUSE00000451197chr4:62287526-6228756540RGS3_MOUSE199-212140--
1.19ENSMUST0000008452119ENSMUSE00000451192chr4:62292158-62292354197RGS3_MOUSE212-277660--
1.20bENSMUST0000008452120bENSMUSE00000451183chr4:62295480-6229556384RGS3_MOUSE278-305280--
1.21ENSMUST0000008452121ENSMUSE00000451176chr4:62301751-62301862112RGS3_MOUSE306-343380--
1.22ENSMUST0000008452122ENSMUSE00000451169chr4:62307718-6230776144RGS3_MOUSE343-357150--
1.23bENSMUST0000008452123bENSMUSE00000451165chr4:62313748-62313870123RGS3_MOUSE358-398410--
1.29dENSMUST0000008452129dENSMUSE00000891286chr4:62350533-623516601128RGS3_MOUSE399-7743760--
1.30aENSMUST0000008452130aENSMUSE00000526739chr4:62358305-6235836662RGS3_MOUSE775-795210--
1.32ENSMUST0000008452132ENSMUSE00000526738chr4:62361032-62361133102RGS3_MOUSE795-829350--
1.33ENSMUST0000008452133ENSMUSE00000526734chr4:62361388-6236144962RGS3_MOUSE829-850220--
1.35bENSMUST0000008452135bENSMUSE00000526733chr4:62362068-62362234167RGS3_MOUSE850-905560--
1.36cENSMUST0000008452136cENSMUSE00000526731chr4:62363094-62364052959RGS3_MOUSE906-966610--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:100
 aligned with RGS3_MOUSE | Q9DC04 from UniProtKB/Swiss-Prot  Length:966

    Alignment length:106
                             1                                                                                                        
                             |       9        19        29        39        49        59        69        79        89        99      
           RGS3_MOUSE     - -MNRFNGLCKVCSERRYRQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDGG 105
               SCOP domains d1whda_ A: Regul ator of G-protein signaling 3, RGS3                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------PDZ-1whdA01 A:18-92                                                        ------------- Pfam domains
         Sec.struct. author ..............ee-eeeeee.......eee.......eeee.....hhhh.......eeee..ee.....hhhhhhhhhh...eeeeeeee..-----..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------PDZ  PDB: A:18-94 UniProt: 18-95                                              ---------- PROSITE
           Transcript 1 (1) -Exon 1.13a        Exon 1.15c  PDB: A:19-46    ----------------------------------Exon 1.17 UniProt: 81-198 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.16b  PDB: A:46-81            ------------------------ Transcript 1 (2)
                 1whd A   1 GSSGSSGEGDPENGEK-LQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVS-----GPSSG 100
                                    10     | |19        29        39        49        59        69        79        89     |   - |    
                                          16 |                                                                            95    96    
                                            17                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1WHD)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: PDZ-like (184)

(-) Gene Ontology  (9, 9)

NMR Structure(hide GO term definitions)
Chain A   (RGS3_MOUSE | Q9DC04)
molecular function
    GO:0005096    GTPase activator activity    Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0009968    negative regulation of signal transduction    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1whd)
 
  Sites
(no "Sites" information available for 1whd)
 
  Cis Peptide Bonds
    Ser A:36 - Pro A:37   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1whd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RGS3_MOUSE | Q9DC04
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RGS3_MOUSE | Q9DC04
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1WHD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WHD)