|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WFE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WFE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WFE) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WFE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:86 aligned with ZFAN1_MOUSE | Q8BFR6 from UniProtKB/Swiss-Prot Length:268 Alignment length:112 36 46 56 66 76 86 96 106 116 126 136 ZFAN1_MOUSE 27 GCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVDAKTGGAASKGRKGAKSSG 138 SCOP domains d1wf ea_ A: AN1-type zinc finger protein 1 SCOP domains CATH domains 1wfe A00 A:1-86 Riken cdna 2310008m20 protein CATH domains Pfam domains -------------------------------------zf-AN1-1wfeA01 A:28-70 -------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ZF_AN1 PDB: - UniProt: 7-54------ZF_AN1 PDB: A:25-71 UniProt: 61-107 ------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1wfe A 1 GSSG----------SSGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVR------SG----------PSSG 86 | - | 10 20 30 40 50 60 70 80 || - 84 4 5 80 81| 83 82
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (ZFAN1_MOUSE | Q8BFR6)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|