|   | 
| 
 | 
 | 
| 
 
 |  | 
 
 Description
Description| 
 
 | 
 
 Compounds
Compounds| 
 | ||||||||||||||||||||||||||||||||||||||||||||
 
 Chains, Units
Chains, Units| 
 Summary Information (see also Sequences/Alignments below) | 
 
 Ligands, Modified Residues, Ions  (1, 2)
Ligands, Modified Residues, Ions  (1, 2)| NMR Structure (1, 2) 
 | 
 
 Sites  (2, 2)
Sites  (2, 2)| NMR Structure (2, 2) 
 | 
 
 SS Bonds  (0, 0)
SS Bonds  (0, 0)| (no "SS Bond" information available for 1WYS) | 
 
 Cis Peptide Bonds  (0, 0)
Cis Peptide Bonds  (0, 0)| (no "Cis Peptide Bond" information available for 1WYS) | 
 
 SAPs(SNPs)/Variants  (0, 0)
SAPs(SNPs)/Variants  (0, 0)| (no "SAP(SNP)/Variant" information available for 1WYS) | 
 
 PROSITE Motifs  (1, 2)
PROSITE Motifs  (1, 2)| NMR Structure (1, 2) 
 | ||||||||||||||||||||||||
 
 Exons   (0, 0)
Exons   (0, 0)| (no "Exon" information available for 1WYS) | 
 
 Sequences/Alignments
Sequences/Alignments| NMR Structure Chain A from PDB Type:PROTEIN Length:75 aligned with ZFAN1_MOUSE | Q8BFR6 from UniProtKB/Swiss-Prot Length:268 Alignment length:145 1 | 3 13 23 33 43 53 63 73 83 93 103 113 123 133 ZFAN1_MOUSE - -------MAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVDAKTGGAASKGRKGAKSSG 138 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------zf-AN1-1wysA01 A:17-62 ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------ZF_AN1 PDB: A:14-61 UniProt: 7-54 ------ZF_AN1 PDB: A:68-72 UniProt: 61-107 ------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1wys A 1 GSSGSSGMAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSG---------------P-------------------------------------------------------SSG 75 10 20 30 40 50 60 70| - | - - - - - - | 71 72 73 
 | ||||||||||||||||||||
 
 SCOP Domains  (0, 0)
SCOP Domains  (0, 0)| (no "SCOP Domain" information available for 1WYS) | 
 
 CATH Domains  (0, 0)
CATH Domains  (0, 0)| (no "CATH Domain" information available for 1WYS) | 
 
 Pfam Domains  (1, 1)
Pfam Domains  (1, 1)| NMR Structure 
 
 | 
 
 Gene Ontology  (5, 5)
Gene Ontology  (5, 5)| NMR Structure(hide GO term definitions) Chain A   (ZFAN1_MOUSE | Q8BFR6) 
 
 | ||||||||||||||||||||||||||||||||||||||||||||||||
 
 Interactive Views
Interactive Views| 
 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Still Images
Still Images| 
 | ||||||||||||||||
 
 Databases
Databases| 
 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Analysis Tools
Analysis Tools| 
 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Entries Sharing at Least One Protein Chain (UniProt ID)
Entries Sharing at Least One Protein Chain (UniProt ID) 
 Related Entries Specified in the PDB File
Related Entries Specified in the PDB File| 
 | 
 |