|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WYS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WYS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WYS) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WYS) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:75 aligned with ZFAN1_MOUSE | Q8BFR6 from UniProtKB/Swiss-Prot Length:268 Alignment length:145 1 | 3 13 23 33 43 53 63 73 83 93 103 113 123 133 ZFAN1_MOUSE - -------MAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVDAKTGGAASKGRKGAKSSG 138 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------zf-AN1-1wysA01 A:17-62 ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------ZF_AN1 PDB: A:14-61 UniProt: 7-54 ------ZF_AN1 PDB: A:68-72 UniProt: 61-107 ------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1wys A 1 GSSGSSGMAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSG---------------P-------------------------------------------------------SSG 75 10 20 30 40 50 60 70| - | - - - - - - | 71 72 73
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1WYS) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WYS) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (ZFAN1_MOUSE | Q8BFR6)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|