1W6U - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF HUMAN DECR TERNARY COMPLEX

Authors :   M. S. Alphey, E. Byres, D. Li, W. N. Hunter

Date :   24 Aug 04 (Deposition) - 28 Oct 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.75

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Dienoyl Coa-Reductase, Short Chain Dehydrogenase, Beta- Oxidation, Nadp, Oxidoreductase, Reductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. S. Alphey, W. Yu, E. Byres, D. Li, W. N. Hunter
Structure And Reactivity Of Human Mitochondrial 2, 4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions In A Distinctive Short-Chain Reductase Active Site
J. Biol. Chem. V. 280 3068 2005
PubMed-ID: 15531764 | Reference-DOI: 10.1074/JBC.M411069200

Molecule 1 - 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL PRECURSOR
	Chains	:	A, B, C, D
	EC Number	:	1.3.1.34
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PLM1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Organelle	:	MITOCHONDRIAL
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	COFACTOR (N) NADP SUBSTRATE (S) 2,4- HEXADIENOYL-COA
	Synonym	:	2,4-DIENOYL-COA REDUCTASE [NADPH], 4-ENOYL-COA REDUCTASE [NADPH]

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 8)

No.	Name	Count	Type	Full Name
1	HXC	4	Ligand/Ion	HEXANOYL-COENZYME A
2	NAP	4	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:119 , ALA A:146 , GLY A:147 , ASN A:148 , PHE A:149 , SER A:157 , ASN A:159 , THR A:163 , THR A:197 , TYR A:199 , SER A:210 , NAP A:1329 , HOH A:2075 , HOH A:2132 , HOH A:2134 , HOH A:2137 , GLU D:326	BINDING SITE FOR RESIDUE HXC A1330
2	AC2	SOFTWARE	ARG B:91 , ARG B:119 , GLY B:147 , ASN B:148 , PHE B:149 , SER B:157 , ASN B:159 , ALA B:160 , TYR B:199 , NAP B:1330 , HOH B:2069 , HOH B:2147 , HOH B:2148 , GLU C:326 , HOH C:2126	BINDING SITE FOR RESIDUE HXC B1331
3	AC3	SOFTWARE	GLU B:310 , GLU B:326 , ALA C:146 , GLY C:147 , ASN C:148 , PHE C:149 , SER C:157 , ASN C:159 , THR C:163 , THR C:197 , TYR C:199 , NAP C:1329 , HOH C:2047 , HOH C:2079 , HOH C:2128 , HOH C:2130 , HOH C:2131	BINDING SITE FOR RESIDUE HXC C1330
4	AC4	SOFTWARE	GLU A:326 , ARG D:91 , ALA D:146 , GLY D:147 , ASN D:148 , PHE D:149 , SER D:157 , ASN D:159 , THR D:163 , ILE D:164 , LYS D:214 , NAP D:1328 , HOH D:2161 , HOH D:2162	BINDING SITE FOR RESIDUE HXC D1329
5	AC5	SOFTWARE	GLY A:66 , THR A:69 , GLY A:70 , LEU A:71 , SER A:90 , ARG A:91 , LYS A:92 , CYS A:116 , ASP A:117 , VAL A:118 , ASN A:144 , ALA A:145 , ALA A:146 , ILE A:195 , THR A:196 , LYS A:214 , PRO A:240 , GLY A:241 , PRO A:242 , ILE A:243 , HXC A:1330 , HOH A:2129 , HOH A:2130 , HOH A:2131 , HOH A:2132	BINDING SITE FOR RESIDUE NAP A1329
6	AC6	SOFTWARE	GLY B:66 , THR B:69 , GLY B:70 , LEU B:71 , SER B:90 , ARG B:91 , LYS B:92 , CYS B:116 , ASP B:117 , VAL B:118 , ARG B:119 , ASN B:144 , ALA B:145 , ALA B:146 , ILE B:167 , ILE B:195 , THR B:196 , LYS B:214 , PRO B:240 , GLY B:241 , PRO B:242 , ILE B:243 , HXC B:1331 , HOH B:2060 , HOH B:2144 , HOH B:2146	BINDING SITE FOR RESIDUE NAP B1330
7	AC7	SOFTWARE	GLY C:66 , THR C:69 , GLY C:70 , LEU C:71 , SER C:90 , ARG C:91 , LYS C:92 , CYS C:116 , ASP C:117 , VAL C:118 , ASN C:144 , ALA C:145 , ALA C:146 , ILE C:195 , THR C:196 , LYS C:214 , PRO C:240 , GLY C:241 , PRO C:242 , ILE C:243 , THR C:245 , HXC C:1330 , HOH C:2009 , HOH C:2010 , HOH C:2127 , HOH C:2128 , HOH C:2129	BINDING SITE FOR RESIDUE NAP C1329
8	AC8	SOFTWARE	GLY D:66 , THR D:69 , GLY D:70 , LEU D:71 , SER D:90 , ARG D:91 , LYS D:92 , CYS D:116 , ASP D:117 , VAL D:118 , ASN D:144 , ALA D:145 , ALA D:146 , ILE D:195 , THR D:196 , LYS D:214 , PRO D:240 , GLY D:241 , PRO D:242 , ILE D:243 , HXC D:1329 , HOH D:2033 , HOH D:2156 , HOH D:2157 , HOH D:2158 , HOH D:2159	BINDING SITE FOR RESIDUE NAP D1328

(no "SS Bond" information available for 1W6U)

(no "Cis Peptide Bond" information available for 1W6U)

(no "SAP(SNP)/Variant" information available for 1W6U)

(no "PROSITE Motif" information available for 1W6U)

Asymmetric/Biological Unit (9, 36)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000220764	1a	ENSE00001087833	chr8:91013633-91013789	157	DECR_HUMAN	1-23	23	0	-	-
1.6b	ENST00000220764	6b	ENSE00001154275	chr8:91029352-91029554	203	DECR_HUMAN	24-91	68	4	A:35-91 B:34-91 C:36-91 D:34-91	57 58 56 58
1.7c	ENST00000220764	7c	ENSE00001087854	chr8:91031137-91031194	58	DECR_HUMAN	91-110	20	4	A:91-110 B:91-110 C:91-110 D:91-110	20 20 20 20
1.8	ENST00000220764	8	ENSE00001087852	chr8:91031314-91031400	87	DECR_HUMAN	111-139	29	4	A:111-139 B:111-139 C:111-139 D:111-139	29 29 29 29
1.9b	ENST00000220764	9b	ENSE00001087839	chr8:91033137-91033284	148	DECR_HUMAN	140-189	50	4	A:140-189 B:140-189 C:140-189 D:140-189	50 50 50 50
1.12e	ENST00000220764	12e	ENSE00001087830	chr8:91049069-91049168	100	DECR_HUMAN	189-222	34	4	A:189-222 B:189-222 C:189-222 D:189-222	34 34 34 34
1.13c	ENST00000220764	13c	ENSE00001087848	chr8:91054956-91055028	73	DECR_HUMAN	222-246	25	4	A:222-245 B:222-245 C:222-245 D:222-245	24 24 24 24
1.14b	ENST00000220764	14b	ENSE00001087836	chr8:91057077-91057223	147	DECR_HUMAN	247-295	49	4	A:252-295 B:256-295 C:247-295 (gaps) D:258-295	44 40 49 38
1.16	ENST00000220764	16	ENSE00001087828	chr8:91063905-91063967	63	DECR_HUMAN	296-316	21	4	A:296-316 B:296-316 C:296-316 D:296-316	21 21 21 21
1.17f	ENST00000220764	17f	ENSE00002128622	chr8:91064066-91064236	171	DECR_HUMAN	317-335	19	4	A:317-328 B:317-329 C:317-328 D:317-327	12 13 12 11

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:288
 aligned with DECR_HUMAN | Q16698 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:294
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324    
           DECR_HUMAN    35 NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL 328
               SCOP domains d1w6ua_ A: 2,4-dienoyl-CoA reductase, mitochondrial (DECR)                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhh................eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....------....hhhhhhhhh........hhhhhhhhhhhhhhhhhh.....eeee..hhhhhhhh.hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.6b  PDB: A:35-91 UniProt: 24-91 [INCOMPLETE]      -------------------Exon 1.8  PDB: A:111-139     -------------------------------------------------Exon 1.12e  PDB: A:189-222        ------------------------Exon 1.14b  PDB: A:252-295 UniProt: 247-295      Exon 1.16            Exon 1.17f   Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.7c           -----------------------------Exon 1.9b  PDB: A:140-189 UniProt: 140-189        --------------------------------Exon 1.13c  PDB: A:222-24---------------------------------------------------------------------------------- Transcript 1 (2)
                 1w6u A  35 NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT------LDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL 328
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244|      254       264       274       284       294       304       314       324    
                                                                                                                                                                                                                                            245    252

Chain B from PDB  Type:PROTEIN  Length:286
 aligned with DECR_HUMAN | Q16698 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:296
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323      
           DECR_HUMAN    34 QNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELI 329
               SCOP domains d1w6ub_ B: 2,4-dienoyl-CoA reductase, mitochondrial (DECR)                                                                                                                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh................eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.....----------.hhhhhhhh........hhhhhhhhhhhhhhhhhh.....eeee..hhhhhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6b  PDB: B:34-91 UniProt: 24-91 [INCOMPLETE]       -------------------Exon 1.8  PDB: B:111-139     -------------------------------------------------Exon 1.12e  PDB: B:189-222        ------------------------Exon 1.14b  PDB: B:256-295 UniProt: 247-295      Exon 1.16            Exon 1.17f    Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.7c           -----------------------------Exon 1.9b  PDB: B:140-189 UniProt: 140-189        --------------------------------Exon 1.13c  PDB: B:222-24----------------------------------------------------------------------------------- Transcript 1 (2)
                 1w6u B  34 MNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT----------GTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELI 329
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 |       -  |    263       273       283       293       303       313       323      
                                                                                                                                                                                                                                             245        256

Chain C from PDB  Type:PROTEIN  Length:286
 aligned with DECR_HUMAN | Q16698 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:293
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325   
           DECR_HUMAN    36 TEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL 328
               SCOP domains d1w6uc_ C: 2,4-dienoyl-CoA reductase, mitochondrial (DECR)                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh................eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.....-...------hhhhhhhhh........hhhhhhhhhhhhhhhhhh.....eeee..hhhhhhhh.hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6b  PDB: C:36-91 UniProt: 24-91 [INCOMPLETE]     -------------------Exon 1.8  PDB: C:111-139     -------------------------------------------------Exon 1.12e  PDB: C:189-222        ------------------------Exon 1.14b  PDB: C:247-295 (gaps)                Exon 1.16            Exon 1.17f   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.7c           -----------------------------Exon 1.9b  PDB: C:140-189 UniProt: 140-189        --------------------------------Exon 1.13c  PDB: C:222-24---------------------------------------------------------------------------------- Transcript 1 (2)
                 1w6u C  36 TEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT-GAF------GTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL 328
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245 | |     -|      265       275       285       295       305       315       325   
                                                                                                                                                                                                                                           245 | |    256                                                                        
                                                                                                                                                                                                                                             247 |                                                                               
                                                                                                                                                                                                                                               249

Chain D from PDB  Type:PROTEIN  Length:282
 aligned with DECR_HUMAN | Q16698 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:294
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323    
           DECR_HUMAN    34 QNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEE 327
               SCOP domains d1w6ud_ D: 2,4-dienoyl-CoA reductase, mitochondrial (DECR)                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) --------------------------------adh_short_C2-1w6uD01 D:66-304                                                                                                                                                                                                                  ----------------------- Pfam domains (1)
           Pfam domains (2) --------------------------------adh_short_C2-1w6uD02 D:66-304                                                                                                                                                                                                                  ----------------------- Pfam domains (2)
           Pfam domains (3) --------------------------------adh_short_C2-1w6uD03 D:66-304                                                                                                                                                                                                                  ----------------------- Pfam domains (3)
           Pfam domains (4) --------------------------------adh_short_C2-1w6uD04 D:66-304                                                                                                                                                                                                                  ----------------------- Pfam domains (4)
         Sec.struct. author .hhhhhhhhhh................eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee..ee.------------..hhhhhhh.....eehhhhhhhhhhhhhhhhh.....eeee..hhhhhhhh.hhhhh.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.6b  PDB: D:34-91 UniProt: 24-91 [INCOMPLETE]       -------------------Exon 1.8  PDB: D:111-139     -------------------------------------------------Exon 1.12e  PDB: D:189-222        ------------------------Exon 1.14b  PDB: D:258-295 UniProt: 247-295      Exon 1.16            Exon 1.17f  Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.7c           -----------------------------Exon 1.9b  PDB: D:140-189 UniProt: 140-189        --------------------------------Exon 1.13c  PDB: D:222-24--------------------------------------------------------------------------------- Transcript 1 (2)
                 1w6u D  34 MNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT------------FEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEE 327
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 |       -    |  263       273       283       293       303       313       323    
                                                                                                                                                                                                                                             245          258

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: 2,4-dienoyl-CoA reductase, mitochondrial (DECR) (3)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d1w6ua_	A:
1b	d1w6ub_	B:
1c	d1w6uc_	C:
1d	d1w6ud_	D:

(no "CATH Domain" information available for 1W6U)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: adh_short_C2 (98)

Homo sapiens (Human) (7)

1a	adh_short_C2-1w6uD01	D:66-304
1b	adh_short_C2-1w6uD02	D:66-304
1c	adh_short_C2-1w6uD03	D:66-304
1d	adh_short_C2-1w6uD04	D:66-304

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (DECR_HUMAN | Q16698)

molecular function
	GO:0008670	2,4-dienoyl-CoA reductase (NADPH) activity	Catalysis of the reaction: trans-2,3-didehydroacyl-CoA + NADP+ = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH + H+.
	GO:0070402	NADPH binding	Interacting selectively and non-covalently with the reduced form, NADPH, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016651	oxidoreductase activity, acting on NAD(P)H	Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
	GO:0006635	fatty acid beta-oxidation	A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HXC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1w6u)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1w6u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DECR_HUMAN \| Q16698
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.1.34
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DECR_HUMAN \| Q16698
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DECR_HUMAN \| Q16698	:	1w73 1w8d

1w73	BINARY STRUCTURE OF HUMAN DECR SOLVED BY SEMET SAD.
1w8d	BINARY STRUCTURE OF HUMAN DECR.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (9, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File