|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 5)| Asymmetric Unit (4, 5) Biological Unit 1 (3, 12) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2CHH) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CHH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CHH) |
Exons (0, 0)| (no "Exon" information available for 2CHH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:113 aligned with Q8XUA5_RALSO | Q8XUA5 from UniProtKB/TrEMBL Length:114 Alignment length:113 11 21 31 41 51 61 71 81 91 101 111 Q8XUA5_RALSO 2 AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG 114 SCOP domains d2chha_ A: Mannose-specific lectin RS-IIL SCOP domains CATH domains 2chhA00 A:1-113 Calcium-mediated lectin CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 2chh A 1 AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG 113 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CHH) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q8XUA5_RALSO | Q8XUA5)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|