|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (0, 0)| (no "Site" information available for 1VJG) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1VJG) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VJG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VJG) |
Exons (0, 0)| (no "Exon" information available for 1VJG) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:201 aligned with Q8YWS4_NOSS1 | Q8YWS4 from UniProtKB/TrEMBL Length:206 Alignment length:201 14 24 34 44 54 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 Q8YWS4_NOSS1 5 SKTQIRICFVGDSFVNGTGDPECLGWTGRVCVNANKKGYDVTYYNLGIRRDTSSDIAKRWLQEVSLRLHKEYNSLVVFSFGLNDTTLENGKPRVSIAETIKNTREILTQAKKLYPVLMISPAPYIEQQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEKPSVWLHEAKANDGVHPQAGGYTEFARIVENWDAWLNWF 205 SCOP domains d1vjga_ A: Hypothetical protein alr1529 SCOP domains CATH domains 1vjgA00 A:5-205 [code=3.40.50.1110, no name defined] CATH domains Pfam domains -------Lipase_GDSL_2-1vjgA01 A:12-191 -------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vjg A 5 SKTQIRICFVGDSFVNGTGDPECLGWTGRVCVNANKKGYDVTYYNLGIRRDTSSDIAKRWLQEVSLRLHKEYNSLVVFSFGLNDTTLENGKPRVSIAETIKNTREILTQAKKLYPVLmISPAPYIEQQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEKPSVWLHEAKANDGVHPQAGGYTEFARIVENWDAWLNWF 205 14 24 34 44 54 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 122-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1VJG)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|