|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1V91) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V91) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1V91) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:38 aligned with T3D1B_PIRLC | P83257 from UniProtKB/Swiss-Prot Length:37 Alignment length:38 37 10 20 30 | T3D1B_PIRLC 1 ACVGDGQRCASWSGPYCCDGYYCSCRSMPYCRCRNNS- - SCOP domains -------------------------------------- SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains -------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -MU_AGATOXIN PDB: A:2-33 ----- PROSITE Transcript -------------------------------------- Transcript 1v91 A 1 ACVGDGQRCASWSGPYCCDGYYCSCRSMPYCRCRNNSx 38 10 20 30 | 38-NH2
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1V91) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1V91) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1V91) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (T3D1B_PIRLC | P83257)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|