1UWC - JenaLib

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN A:79 , THR A:83 , GLY A:98 , TYR A:101 , ILE A:102 , HOH A:2148 , HOH A:2334 , ASN B:43 , ILE B:105 , SER B:106 , VAL B:107 , GLN B:108 , ASP B:109 , GLN B:110	BINDING SITE FOR RESIDUE NAG A 262
2	AC2	SOFTWARE	ASN A:43 , ILE A:105 , SER A:106 , VAL A:107 , GLN A:108 , ASP A:109 , GLN A:110 , ASN B:79 , THR B:83 , GLY B:98 , ILE B:102 , HOH B:2183 , HOH B:2364	BINDING SITE FOR RESIDUE NAG B 262
3	AC3	SOFTWARE	ARG A:162 , ALA A:207 , HIS A:208 , HOH A:2272 , HOH A:2338 , HOH A:2339 , HOH A:2340 , HOH A:2341	BINDING SITE FOR RESIDUE SO4 A1263
4	AC4	SOFTWARE	ASN A:193 , ASN A:244 , HOH A:2342 , HOH A:2343 , HOH A:2344	BINDING SITE FOR RESIDUE SO4 A1264
5	AC5	SOFTWARE	THR A:68 , ASP A:77 , TYR A:80 , TYR A:100 , SER A:133 , LEU A:134 , HIS A:247 , HOH A:2335 , HOH A:2336 , HOH A:2337	BINDING SITE FOR RESIDUE FER A1262
6	AC6	SOFTWARE	PRO A:218 , ASN A:223 , HOH A:2345 , SER B:192 , ASN B:193 , TRP B:214 , VAL B:216 , GLN B:238 , HOH B:2333	BINDING SITE FOR RESIDUE FER A1265
7	AC7	SOFTWARE	THR B:68 , ASP B:77 , TYR B:80 , TYR B:100 , SER B:133 , LEU B:134 , HIS B:247 , HOH B:2365 , HOH B:2366 , HOH B:2367	BINDING SITE FOR RESIDUE FER B1262

SS Bonds (6, 6)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:261
 aligned with FAEA_ASPNG | O42807 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:261
                                                                                                                                                                                                                                                                                             281 
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281 
           FAEA_ASPNG    22 ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW-   -
               SCOP domains d1uwca_ A: Feruloyl esterase A                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1uwcA00 A:1-261  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..hhhhhhhhhhhhhhhhhh..........eeeeeeeee....eeeeeeee....eeeeee....hhhhhhhhh...eee..........eeehhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhhhh.........eeeeee...hhhhh.hhhhh.....eeeee....hhh.eeee.....hhhhhhh....hhhhhee..ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------LIPASE_SER----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1uwc A   1 ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV 261
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260

Chain B from PDB  Type:PROTEIN  Length:261
 aligned with FAEA_ASPNG | O42807 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:261
                                                                                                                                                                                                                                                                                             281 
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281 
           FAEA_ASPNG    22 ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW-   -
               SCOP domains d1uwcb_ B: Feruloyl esterase A                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1uwcB00 B:1-261  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) -------------------------------------------------------------Lipase_3-1uwcB01 B:62-204                                                                                                                      --------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------Lipase_3-1uwcB02 B:62-204                                                                                                                      --------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .eee..hhhhhhhhhhhhhhhhhhhhh........eeeeeeee....eeeeeeee....eeeeee....hhhhhhhhh...eee..........eeehhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhhhh.........eeeeee...hhhhh.hhhhh.....eeeee........eeee.....hhhhhhh....hhhhhee..ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------LIPASE_SER----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1uwc B   1 ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV 261
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (FAEA_ASPNG | O42807)

molecular function
	GO:0052689	carboxylic ester hydrolase activity	Catalysis of the hydrolysis of a carboxylic ester bond.
	GO:0030248	cellulose binding	Interacting selectively and non-covalently with cellulose.
	GO:0030600	feruloyl esterase activity	Catalysis of the reaction: feruloyl-polysaccharide + H2O = ferulate + polysaccharide.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0016998	cell wall macromolecule catabolic process	The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
	GO:0030245	cellulose catabolic process	The chemical reactions and pathways resulting in the breakdown of cellulose, a linear beta1-4 glucan of molecular mass 50-400 kDa with the pyranose units in the -4C1 conformation.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0045490	pectin catabolic process	The chemical reactions and pathways resulting in the breakdown of pectin, a polymer containing a backbone of alpha-1,4-linked D-galacturonic acid residues.
	GO:0000272	polysaccharide catabolic process	The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
	GO:0045493	xylan catabolic process	The chemical reactions and pathways resulting in the breakdown of xylan, a polymer containing a beta-1,4-linked D-xylose backbone.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FER	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:217 - Pro A:218	[ RasMol ]
		Asp B:217 - Pro B:218	[ RasMol ]
		Leu A:199 - Pro A:200	[ RasMol ]
		Leu B:199 - Pro B:200	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1uwc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FAEA_ASPNG \| O42807
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.1.73
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 7)

Sites (7, 7)