|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1UAW) |
Sites (0, 0)| (no "Site" information available for 1UAW) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1UAW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UAW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UAW) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1UAW) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:77 aligned with MSI1H_MOUSE | Q61474 from UniProtKB/Swiss-Prot Length:362 Alignment length:77 29 39 49 59 69 79 89 MSI1H_MOUSE 20 CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAF 96 SCOP domains d1uawa_ A: Musashi-1 SCOP domains CATH domains 1uawA00 A:20-96 [code=3.30.70.330, no name defined] CATH domains Pfam domains --RRM_1-1uawA01 A:22-91 ----- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE RRM PDB: A:20-96 UniProt: 20-110 PROSITE Transcript ----------------------------------------------------------------------------- Transcript 1uaw A 20 CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAF 96 29 39 49 59 69 79 89
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (9, 9)|
NMR Structure(hide GO term definitions) Chain A (MSI1H_MOUSE | Q61474)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|