Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE REDUCED DISULPHIDE BOND ISOMERASE, DSBC, FROM ESCHERICHIA COLI
 
Authors :  K. Banaszak, I. Mechin, G. Frost, W. Rypniewski
Date :  04 Jun 04  (Deposition) - 05 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Dimer, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Banaszak, I. Mechin, G. Frost, W. Rypniewski
Structure Of The Reduced Disulfide-Bond Isomerase Dsbc From Escherichia Coli.
Acta Crystallogr. , Sect. D V. 60 1747 2004
PubMed-ID: 15388920  |  Reference-DOI: 10.1107/S0907444904018359
(for further references see the PDB file header)

(-) Compounds

Molecule 1
    ChainsA
    EC Number5.3.4.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPDM801
    Expression System StrainBL21 (DE2)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneDSBC, XPRA, B2893, Z4231, ECS3765
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TJD)

(-) Sites  (0, 0)

(no "Site" information available for 1TJD)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:141 -A:163

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:49 -Pro A:50
2Thr A:182 -Pro A:183

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TJD)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOREDOXIN_2PS51352 Thioredoxin domain profile.DSBC_ECO5736-231  1A:16-211
DSBC_ECOLI36-231  1A:16-211
2THIOREDOXIN_1PS00194 Thioredoxin family active site.DSBC_ECO57110-128  1A:90-108
DSBC_ECOLI110-128  1A:90-108
Biological Unit 1 (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOREDOXIN_2PS51352 Thioredoxin domain profile.DSBC_ECO5736-231  2A:16-211
DSBC_ECOLI36-231  2A:16-211
2THIOREDOXIN_1PS00194 Thioredoxin family active site.DSBC_ECO57110-128  2A:90-108
DSBC_ECOLI110-128  2A:90-108

(-) Exons   (0, 0)

(no "Exon" information available for 1TJD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:216
 aligned with DSBC_ECO57 | P0AEG7 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:216
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      
           DSBC_ECO57    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 236
               SCOP domains d1tjda2 A:1-60                                              d1tjda1 A:61-216 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                           SCOP domains
               CATH domains 1tjdA01 A:1-61  [code=3.10.450.70, no name defined]          ----------------1tjdA02 A:78-216 Glutaredoxin                                                                                                               CATH domains
               Pfam domains ----DsbC_N-1tjdA02 A:5-58                                 ----------------------Thioredoxin_2-1tjdA01 A:81-206                                                                                                ---------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh....eeee.....eeeeee..eeeeee.....ee....ee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhhh..........hhhhhhhhhhhh......eee.....eee...hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ---------------THIOREDOXIN_2  PDB: A:16-211 UniProt: 36-231                                                                                                                                                        ----- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1tjd A   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      

Chain A from PDB  Type:PROTEIN  Length:216
 aligned with DSBC_ECOLI | P0AEG6 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:216
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      
           DSBC_ECOLI    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 236
               SCOP domains d1tjda2 A:1-60                                              d1tjda1 A:61-216 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                           SCOP domains
               CATH domains 1tjdA01 A:1-61  [code=3.10.450.70, no name defined]          ----------------1tjdA02 A:78-216 Glutaredoxin                                                                                                               CATH domains
               Pfam domains ----DsbC_N-1tjdA02 A:5-58                                 ----------------------Thioredoxin_2-1tjdA01 A:81-206                                                                                                ---------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh....eeee.....eeeeee..eeeeee.....ee....ee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhhh..........hhhhhhhhhhhh......eee.....eee...hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------THIOREDOXIN_2  PDB: A:16-211 UniProt: 36-231                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ------------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1tjd A   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric Unit

(-) Gene Ontology  (6, 8)

Asymmetric Unit(hide GO term definitions)
Chain A   (DSBC_ECOLI | P0AEG6)
molecular function
    GO:0003756    protein disulfide isomerase activity    Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
    GO:0015035    protein disulfide oxidoreductase activity    Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0030288    outer membrane-bounded periplasmic space    The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain A   (DSBC_ECO57 | P0AEG7)
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tjd)
 
  Sites
(no "Sites" information available for 1tjd)
 
  Cis Peptide Bonds
    Gly A:49 - Pro A:50   [ RasMol ]  
    Thr A:182 - Pro A:183   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tjd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DSBC_ECO57 | P0AEG7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  DSBC_ECOLI | P0AEG6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.4.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DSBC_ECO57 | P0AEG7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DSBC_ECOLI | P0AEG6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DSBC_ECO57 | P0AEG71eej 1g0t 1jzd 1jzo
        DSBC_ECOLI | P0AEG61eej 1g0t 1jzd 1jzo 2iyj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TJD)