1JZO - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   DSBC C101S

Authors :   P. W. Haebel, D. Goldstone, F. Katzen, J. Beckwith, P. Metcalf

Date :   17 Sep 01 (Deposition) - 08 Mar 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.92

Chains :   Asym./Biol. Unit : A,B

Keywords :   Disulfide Bond Isomerase, Thiol Oxidoreductase, Dsbc, Thioredoxin Fold (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. W. Haebel, D. Goldstone, F. Katzen, J. Beckwith, P. Metcalf
The Disulfide Bond Isomerase Dsbc Is Activated By An Immunoglobulin-Fold Thiol Oxidoreductase: Crystal Structure Of The Dsbc-Dsbdalpha Complex.
Embo J. V. 21 4774 2002
PubMed-ID: 12234918 | Reference-DOI: 10.1093/EMBOJ/CDF489
(for further references see the PDB file header)

Molecule 1
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PPROEX HT
	Expression System Strain	:	BL21 DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	DSBC
	Gene	:	DSBC
	Mutation	:	YES
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1JZO)

(no "Site" information available for 1JZO)

Asymmetric/Biological Unit

No.	Residues
1	A:141	-	A:163
2	B:141	-	B:163

Asymmetric/Biological Unit

No.	Residues
1	Gly A:49	-	Pro A:50
2	Thr A:182	-	Pro A:183
3	Gly B:49	-	Pro B:50
4	Thr B:182	-	Pro B:183

(no "SAP(SNP)/Variant" information available for 1JZO)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	THIOREDOXIN_2	PS51352	Thioredoxin domain profile.	DSBC_ECO57	36-231	2	A:16-211 B:16-211
1	THIOREDOXIN_2	PS51352	Thioredoxin domain profile.	DSBC_ECOLI	36-231	2	A:16-211 B:16-211
2	THIOREDOXIN_1	PS00194	Thioredoxin family active site.	DSBC_ECO57	110-128	2	A:90-108 B:90-108
2	THIOREDOXIN_1	PS00194	Thioredoxin family active site.	DSBC_ECOLI	110-128	2	A:90-108 B:90-108

(no "Exon" information available for 1JZO)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:215
 aligned with DSBC_ECO57 | P0AEG7 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:215
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
           DSBC_ECO57    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG 235
               SCOP domains d1jzoa2 A:1-60                                              d1jzoa1 A:61-215 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                          SCOP domains
               CATH domains 1jzoA01 A:1-61  [code=3.10.450.70, no name defined]          ----------------1jzoA02 A:78-215 Glutaredoxin                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh...eeeeee.....eeeeee..eeeeee....eeee..eee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhh...........hhhhhhhhhhhhh.....eee.....eee...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------THIOREDOXIN_2  PDB: A:16-211 UniProt: 36-231                                                                                                                                                        ---- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ----------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jzo A   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG 215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain A from PDB  Type:PROTEIN  Length:215
 aligned with DSBC_ECOLI | P0AEG6 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:215
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
           DSBC_ECOLI    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG 235
               SCOP domains d1jzoa2 A:1-60                                              d1jzoa1 A:61-215 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                          SCOP domains
               CATH domains 1jzoA01 A:1-61  [code=3.10.450.70, no name defined]          ----------------1jzoA02 A:78-215 Glutaredoxin                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh...eeeeee.....eeeeee..eeeeee....eeee..eee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhh...........hhhhhhhhhhhhh.....eee.....eee...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------THIOREDOXIN_2  PDB: A:16-211 UniProt: 36-231                                                                                                                                                        ---- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ----------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jzo A   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG 215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain B from PDB  Type:PROTEIN  Length:216
 aligned with DSBC_ECO57 | P0AEG7 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:216
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      
           DSBC_ECO57    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 236
               SCOP domains d1jzob2 B:1-60                                              d1jzob1 B:61-216 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                           SCOP domains
               CATH domains 1jzoB01 B:1-61  [code=3.10.450.70, no name defined]          ----------------1jzoB02 B:78-216 Glutaredoxin                                                                                                               CATH domains
           Pfam domains (1) ----DsbC_N-1jzoB03 B:5-58                                 ----------------------Thioredoxin_2-1jzoB01 B:81-206                                                                                                ---------- Pfam domains (1)
           Pfam domains (2) ----DsbC_N-1jzoB04 B:5-58                                 ----------------------Thioredoxin_2-1jzoB02 B:81-206                                                                                                ---------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhh....eeeeee.....eeeeee..eeeeee....eee...eee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhh...........hhhhhhhhhhhhh.....eee.....eee...hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------THIOREDOXIN_2  PDB: B:16-211 UniProt: 36-231                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1jzo B   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain B from PDB  Type:PROTEIN  Length:216
 aligned with DSBC_ECOLI | P0AEG6 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:216
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      
           DSBC_ECOLI    21 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 236
               SCOP domains d1jzob2 B:1-60                                              d1jzob1 B:61-216 Disulfide bond isomerase, DsbC, C-terminal domain                                                                                           SCOP domains
               CATH domains 1jzoB01 B:1-61  [code=3.10.450.70, no name defined]          ----------------1jzoB02 B:78-216 Glutaredoxin                                                                                                               CATH domains
           Pfam domains (1) ----DsbC_N-1jzoB03 B:5-58                                 ----------------------Thioredoxin_2-1jzoB01 B:81-206                                                                                                ---------- Pfam domains (1)
           Pfam domains (2) ----DsbC_N-1jzoB04 B:5-58                                 ----------------------Thioredoxin_2-1jzoB02 B:81-206                                                                                                ---------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhh....eeeeee.....eeeeee..eeeeee....eee...eee......eehhhhhhhhhhhhhhhhheee......eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhh..hhhhhhhhhhh...........hhhhhhhhhhhhh.....eee.....eee...hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ---------------THIOREDOXIN_2  PDB: B:16-211 UniProt: 36-231                                                                                                                                                        ----- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) -----------------------------------------------------------------------------------------THIOREDOXIN_1      ------------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1jzo B   1 DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Escherichia coli. Organism_taxid: 562. (43)

1a	1jzoA02	A:78-215
1b	1jzoB02	B:78-216

Architecture: Roll (3276)

Topology: Nuclear Transport Factor 2; Chain: A, (517)

Homologous Superfamily: [code=3.10.450.70, no name defined] (6)

Escherichia coli. Organism_taxid: 562. (5)

2a	1jzoA01	A:1-61
2b	1jzoB01	B:1-61

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Thioredoxin (367)

Family: Thioredoxin_2 (5)

Escherichia coli O157:H7 (2)

1a	Thioredoxin_2-1jzoB01	B:81-206
1b	Thioredoxin_2-1jzoB02	B:81-206

Clan: no clan defined [family: DsbC_N] (3)

Family: DsbC_N (3)

Escherichia coli O157:H7 (2)

2a	DsbC_N-1jzoB03	B:5-58
2b	DsbC_N-1jzoB04	B:5-58

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (DSBC_ECOLI | P0AEG6)

molecular function
	GO:0003756	protein disulfide isomerase activity	Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0030288	outer membrane-bounded periplasmic space	The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain A,B (DSBC_ECO57 | P0AEG7)

biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
cellular component
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jzo)

	Sites
(no "Sites" information available for 1jzo)

	Cis Peptide Bonds
		Gly A:49 - Pro A:50	[ RasMol ]
		Gly B:49 - Pro B:50	[ RasMol ]
		Thr A:182 - Pro A:183	[ RasMol ]
		Thr B:182 - Pro B:183	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1jzo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DSBC_ECO57 \| P0AEG7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	DSBC_ECOLI \| P0AEG6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DSBC_ECO57 \| P0AEG7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	DSBC_ECOLI \| P0AEG6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DSBC_ECO57 \| P0AEG7	:	1eej 1g0t 1jzd 1tjd
	DSBC_ECOLI \| P0AEG6	:	1eej 1g0t 1jzd 1tjd 2iyj

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (2, 2)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (6, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File