Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE C-TYPE LECTIN DOMAIN OF CD23
 
Authors :  R. G. Hibbert, P. Teriete, G. J. Grundy, B. J. Sutton, H. J. Gould, J. M. Mcdonnell
Date :  12 May 04  (Deposition) - 26 Jul 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  C-Type Lectin, Fcerii, Fc Receptor, Ige, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. G. Hibbert, P. Teriete, G. J. Grundy, R. L. Beavil, R. Reljic, V. M. Holers, J. P. Hannan, B. J. Sutton, H. J. Gould, J. M. Mcdonnell
The Structure Of Human Cd23 And Its Interactions With Ige And Cd21
J. Exp. Med. V. 202 751 2005
PubMed-ID: 16172256  |  Reference-DOI: 10.1084/JEM.20050811
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - LOW AFFINITY IMMUNOGLOBULIN EPSILON FC RECEPTOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET5A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentDERCD23
    GeneFCER2, IGEBF
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLYMPHOCYTE IGE RECEPTOR, FC-EPSILON-RII, CD23, IMMUNOGLOBULIN E-BINDING FACTOR

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1T8D)

(-) Sites  (0, 0)

(no "Site" information available for 1T8D)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:5 -A:133
2A:8 -A:19
3A:36 -A:127
4A:104 -A:118

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1T8D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035388R284QFCER2_HUMANPolymorphism8102872AR129Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.FCER2_HUMAN170-277  1A:15-122
2C_TYPE_LECTIN_1PS00615 C-type lectin domain signature.FCER2_HUMAN259-282  1A:104-127

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003466641aENSE00001237098chr19:7766997-776690593FCER2_HUMAN-00--
1.2ENST000003466642ENSE00001397092chr19:7764731-7764625107FCER2_HUMAN1-880--
1.4ENST000003466644ENSE00000874617chr19:7763740-7763627114FCER2_HUMAN8-46390--
1.5ENST000003466645ENSE00000671471chr19:7763295-776324254FCER2_HUMAN46-64190--
1.6ENST000003466646ENSE00000671470chr19:7762475-776241363FCER2_HUMAN64-85220--
1.7ENST000003466647ENSE00000671469chr19:7762184-776212263FCER2_HUMAN85-106220--
1.8ENST000003466648ENSE00001052912chr19:7761961-776189963FCER2_HUMAN106-127220--
1.9ENST000003466649ENSE00000671467chr19:7761800-776171190FCER2_HUMAN127-157311A:1-22
1.10ENST0000034666410ENSE00000671466chr19:7755443-7755292152FCER2_HUMAN157-207511A:2-5251
1.11ENST0000034666411ENSE00000671465chr19:7755151-7755045107FCER2_HUMAN208-243361A:53-8836
1.12bENST0000034666412bENSE00001517758chr19:7754316-7753663654FCER2_HUMAN243-321791A:88-14356

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with FCER2_HUMAN | P06734 from UniProtKB/Swiss-Prot  Length:321

    Alignment length:143
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295   
          FCER2_HUMAN   156 SGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE 298
               SCOP domains d1t8da_ A: Low affinity immunoglobulin epsilon Fc receptor                                                                                      SCOP domains
               CATH domains -----------1t8dA01 A:12-131 Mannose-Binding Protein A, subunit A                                                                   ------------ CATH domains
               Pfam domains ------------------------Lectin_C-1t8dA01 A:25-129                                                                                -------------- Pfam domains
         Sec.struct. author ............ee...eeeeeee...hhhhhhhhhhhh........hhhhhhhhhhhh....eeeeeee......eee........................eeeee...eeeee.......eeeeeee............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------Q-------------- SAPs(SNPs)
                PROSITE (1) --------------C_TYPE_LECTIN_2  PDB: A:15-122 UniProt: 170-277                                                             --------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1         ---------------- PROSITE (2)
           Transcript 1 (1) -Exon 1.10  PDB: A:2-52 UniProt: 157-207            Exon 1.11  PDB: A:53-88             ------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) 1.-------------------------------------------------------------------------------------Exon 1.12b  PDB: A:88-143 UniProt: 243-321 [INCOMPLETE]  Transcript 1 (2)
                 1t8d A   1 SGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: C_Lectin (98)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)
Chain A   (FCER2_HUMAN | P06734)
molecular function
    GO:0019863    IgE binding    Interacting selectively and non-covalently with an immunoglobulin of the IgE isotype.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0005178    integrin binding    Interacting selectively and non-covalently with an integrin.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0002925    positive regulation of humoral immune response mediated by circulating immunoglobulin    Any process that activates or increases the frequency, rate, or extent of a humoral immune response mediated by circulating immunoglobulin.
    GO:0051712    positive regulation of killing of cells of other organism    Any process that activates or increases the frequency, rate or extent of the killing by an organism of cells in another organism.
    GO:0051000    positive regulation of nitric-oxide synthase activity    Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
    GO:0051770    positive regulation of nitric-oxide synthase biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1t8d)
 
  Sites
(no "Sites" information available for 1t8d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t8d)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t8d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FCER2_HUMAN | P06734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FCER2_HUMAN | P06734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FCER2_HUMAN | P067341hli 1kje 1t8c 2h2r 2h2t 4ezm 4g96 4g9a 4gi0 4gj0 4gjx 4gk1 4gko 4j6j 4j6k 4j6l 4j6m 4j6n 4j6p 4j6q 4ki1 5lgk

(-) Related Entries Specified in the PDB File

1t8c