|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1T0Y) |
Sites (0, 0)| (no "Site" information available for 1T0Y) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1T0Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1T0Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1T0Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1T0Y) |
Exons (0, 0)| (no "Exon" information available for 1T0Y) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:90 aligned with TBCB_CAEEL | Q20728 from UniProtKB/Swiss-Prot Length:229 Alignment length:90 10 20 30 40 50 60 70 80 90 TBCB_CAEEL 1 MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED 90 SCOP domains d1t0ya_ A: Ubiquitin-like domain of tubulin folding cofactor B SCOP domains CATH domains 1t0yA00 A:1-90 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1t0y A 1 MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED 90 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1T0Y) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (TBCB_CAEEL | Q20728)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|