Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  APO STRUCTURE OF B. MEGATERIUM TRANSCRIPTION REGULATOR
 
Authors :  M. A. Schumacher, G. S. Allen, M. Diel, G. Seidel, W. Hillen, R. G. Brennan
Date :  30 Mar 04  (Deposition) - 19 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.75
Chains :  Asym./Biol. Unit :  A,D
Keywords :  Allosterism; Phosphoprotein; Transcription Regulation; Gram Positive Bacteria; Ccr (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. A. Schumacher, G. S. Allen, M. Diel, G. Seidel, W. Hillen, R. G. Brennan
Structural Studies On The Apo Transcription Factor Form B. Megaterium
Cell(Cambridge, Mass. ) V. 118 731 2004
PubMed-ID: 15369672  |  Reference-DOI: 10.1016/J.CELL.2004.08.027
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUCOSE-RESISTANCE AMYLASE REGULATOR
    Chains: A, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: CCPA
    Mutation: YES
    Organism Scientific: BACILLUS MEGATERIUM
    Organism Taxid: 1404
    Other Details: APO FORM
    Synonym: CATABOLITE CONTROL PROTEIN;
CCPA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 16)

Asymmetric/Biological Unit (1, 16)
No.NameCountTypeFull Name
1MSE16Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1SXH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SXH)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Val A:265 -Pro A:266
2Arg A:284 -Pro A:285
3Val D:265 -Pro D:266
4Arg D:284 -Pro D:285

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SXH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SXH)

(-) Exons   (0, 0)

(no "Exon" information available for 1SXH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:273
 aligned with CCPA_BACME | P46828 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:273
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329   
           CCPA_BACME    60 TTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK 332
               SCOP domains d1sxha_ A: Glucose-resistance amylase regulator CcpA, C-terminal domain                                                                                                                                                                                                           SCOP domains
               CATH domains 1sxhA01 A:60-160,A:292-323  [code=3.40.50.2300, no name defined]                                     1sxhA02 A:161-291,A:324-332  [code=3.40.50.2300, no name defined]                                                                  1sxhA01 A:60-160,A:292-323      1sxhA02   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....hhhhhhhhhhhhhhhhhhh.eeee.....hhhhhhhhhhhhhh....eeee.....hhhhhhhh......eeee..........eeeehhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhh....hhh.eee...hhhhhhhhhhhhh.......eeee.hhhhhhhhhhhhhh.........eeeee..hhhhhh.....eeee.hhhhhhhhhhhhhhhhhh.......eeee..eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sxh A  60 TTTVGVIIPDISNIFYAELARGIEDIATmYKYNIILSNSDQNQDKELHLLNNmLGKQVDGIIFmSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEmALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTmVRPQLTSVVQPmYDIGAVAmRLLTKYmNKETVDSSIVQLPHRIEFRQSTK 332
                                    69        79        89        99       109  |    119   |   129       139       149       159       169       179       189       199       209       219       229       239       249|      259       269       279  |    289    |  299  |    309       319       329   
                                                       88-MSE                 112-MSE    123-MSE                                                                                                                        250-MSE                         282-MSE     294-MSE 302-MSE  |                       
                                                                                                                                                                                                                                                                                   309-MSE                   


Chain D from PDB  Type:PROTEIN  Length:273
 aligned with CCPA_BACME | P46828 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:273
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329   
           CCPA_BACME    60 TTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK 332
               SCOP domains d1sxhd_ D: Glucose-resistance amylase regulator CcpA, C-terminal domain                                                                                                                                                                                                           SCOP domains
               CATH domains 1sxhD01 D:60-160,D:292-323  [code=3.40.50.2300, no name defined]                                     1sxhD02 D:161-291,D:324-332  [code=3.40.50.2300, no name defined]                                                                  1sxhD01 D:60-160,D:292-323      1sxhD02   CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------Peripla_BP_3-1sxhD01 D:169-331                                                                                                                                     - Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------Peripla_BP_3-1sxhD02 D:169-331                                                                                                                                     - Pfam domains (2)
         Sec.struct. author ..eeeeee....hhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhh.......eee...................eeee..........eeeehhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhhhhhh.....hhh.eee...hhhhhhhhhhhhhh......eeee.hhhhhhhhhhhhhh.........eeeeee.hhhhhh.....eeee.hhhhhhhhhhhhhhhhhh.......eeee..eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sxh D  60 TTTVGVIIPDISNIFYAELARGIEDIATmYKYNIILSNSDQNQDKELHLLNNmLGKQVDGIIFmSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEmALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTmVRPQLTSVVQPmYDIGAVAmRLLTKYmNKETVDSSIVQLPHRIEFRQSTK 332
                                    69        79        89        99       109  |    119   |   129       139       149       159       169       179       189       199       209       219       229       239       249|      259       269       279  |    289    |  299  |    309       319       329   
                                                       88-MSE                 112-MSE    123-MSE                                                                                                                        250-MSE                         282-MSE     294-MSE 302-MSE  |                       
                                                                                                                                                                                                                                                                                   309-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Periplas_BP (97)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,D   (CCPA_BACME | P46828)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1sxh)
 
  Cis Peptide Bonds
    Arg A:284 - Pro A:285   [ RasMol ]  
    Arg D:284 - Pro D:285   [ RasMol ]  
    Val A:265 - Pro A:266   [ RasMol ]  
    Val D:265 - Pro D:266   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sxh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CCPA_BACME | P46828
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CCPA_BACME | P46828
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CCPA_BACME | P46828: 1rzr 1sxg 1sxi 1zvv 2hsg 2jcg 2nzu 2nzv 2oen

(-) Related Entries Specified in the PDB File

1sxg 1sxi