Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE VIRAL ZALPHA DOMAIN BOUND TO LEFT-HANDED Z-DNA
 
Authors :  S. C. Ha, D. Van Quyen, C. A. Wu, K. Lowenhaupt, A. Rich, Y. G. Kim, K. K. Kim
Date :  20 Feb 04  (Deposition) - 17 Aug 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Protein/Z-Dna Complex, Dna Binding Protein/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. C. Ha, N. K. Lokanath, D. Van Quyen, C. A. Wu, K. Lowenhaupt, A. Rich, Y. G. Kim, K. K. Kim
A Poxvirus Protein Forms A Complex With Left-Handed Z-Dna: Crystal Structure Of A Yatapoxvirus Zalpha Bound To Dna.
Proc. Natl. Acad. Sci. Usa V. 101 14367 2004
PubMed-ID: 15448208  |  Reference-DOI: 10.1073/PNAS.0405586101
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-D(*T*CP*GP*CP*GP*CP*G)-3'
    Chains: C, D
    Engineered: YES
    Synthetic: YES
 
Molecule 2 - 34L PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: N-TERMINAL ZALPHA DOMAIN
    Organism Scientific: YABA-LIKE DISEASE VIRUS
    Organism Taxid: 132475

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SFU)

(-) Sites  (0, 0)

(no "Site" information available for 1SFU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SFU)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asn A:65 -Pro A:66
2Asn B:65 -Pro B:66

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SFU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SFU)

(-) Exons   (0, 0)

(no "Exon" information available for 1SFU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:70
 aligned with Q9DHS8_YLDV | Q9DHS8 from UniProtKB/TrEMBL  Length:185

    Alignment length:70
                                    15        25        35        45        55        65        75
           Q9DHS8_YLDV    6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75
               SCOP domains d1sfua_ A: 34L                                                         SCOP domains
               CATH domains 1sfuA00 A:6-75 'winged helix' repressor DNA binding domain             CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh.......hhhhhhhhh..hhhhhhhhhhhhhhh..eeee.....eeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  1sfu A  6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75
                                    15        25        35        45        55        65        75

Chain B from PDB  Type:PROTEIN  Length:70
 aligned with Q9DHS8_YLDV | Q9DHS8 from UniProtKB/TrEMBL  Length:185

    Alignment length:70
                                    15        25        35        45        55        65        75
           Q9DHS8_YLDV    6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75
               SCOP domains d1sfub_ B: 34L                                                         SCOP domains
               CATH domains 1sfuB00 B:6-75 'winged helix' repressor DNA binding domain             CATH domains
           Pfam domains (1) --------------z-alpha-1sfuB01 B:20-72                              --- Pfam domains (1)
           Pfam domains (2) --------------z-alpha-1sfuB02 B:20-72                              --- Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhh.....eehhhhhhhhh..hhhhhhhhhhhhhhh..eeee.....eeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  1sfu B  6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75
                                    15        25        35        45        55        65        75

Chain C from PDB  Type:DNA  Length:6
                                     
                  1sfu C  1 CGCGCG  6

Chain D from PDB  Type:DNA  Length:6
                                     
                  1sfu D  1 CGCGCG  6

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9DHS8_YLDV | Q9DHS8)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003726    double-stranded RNA adenosine deaminase activity    Catalysis of the reaction: adenosine + H2O = inosine + NH3, in a double-stranded RNA molecule.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0039503    suppression by virus of host innate immune response    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sfu)
 
  Sites
(no "Sites" information available for 1sfu)
 
  Cis Peptide Bonds
    Asn A:65 - Pro A:66   [ RasMol ]  
    Asn B:65 - Pro B:66   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sfu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9DHS8_YLDV | Q9DHS8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9DHS8_YLDV | Q9DHS8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SFU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SFU)