![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1SFU) |
(no "Site" information available for 1SFU) |
(no "SS Bond" information available for 1SFU) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 1SFU) |
(no "PROSITE Motif" information available for 1SFU) |
(no "Exon" information available for 1SFU) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:70 aligned with Q9DHS8_YLDV | Q9DHS8 from UniProtKB/TrEMBL Length:185 Alignment length:70 15 25 35 45 55 65 75 Q9DHS8_YLDV 6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75 SCOP domains d1sfua_ A: 34L SCOP domains CATH domains 1sfuA00 A:6-75 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 1sfu A 6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75 15 25 35 45 55 65 75 Chain B from PDB Type:PROTEIN Length:70 aligned with Q9DHS8_YLDV | Q9DHS8 from UniProtKB/TrEMBL Length:185 Alignment length:70 15 25 35 45 55 65 75 Q9DHS8_YLDV 6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75 SCOP domains d1sfub_ B: 34L SCOP domains CATH domains 1sfuB00 B:6-75 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --------------z-alpha-1sfuB01 B:20-72 --- Pfam domains (1) Pfam domains (2) --------------z-alpha-1sfuB02 B:20-72 --- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 1sfu B 6 CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 75 15 25 35 45 55 65 75 Chain C from PDB Type:DNA Length:6 1sfu C 1 CGCGCG 6 Chain D from PDB Type:DNA Length:6 1sfu D 1 CGCGCG 6
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9DHS8_YLDV | Q9DHS8)
|
|
|
|
|
|
|