1RLM - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF YBIV FROM ESCHERICHIA COLI K12

Authors :   A. Roberts, S. Y. Lee, E. Mccullagh, R. E. Silversmith, D. E. Wemmer

Date :   26 Nov 03 (Deposition) - 07 Dec 04 (Release) - 12 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Had Family, Phosphatase, Rossmann Fold, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Roberts, S. Y. Lee, E. Mccullagh, R. E. Silversmith, D. E. Wemmer
Ybiv From Escherichia Coli K12 Is A Had Phosphatase.
Proteins V. 58 790 2005
PubMed-ID: 15657928 | Reference-DOI: 10.1002/PROT.20267

Molecule 1 - PHOSPHATASE
	Chains	:	A, B, C, D
	EC Number	:	3.1.3.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21D
	Expression System Strain	:	BL21 DE3 (PACYC)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	YBIV, B0822
	Mutation	:	YES
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	GOL	6	Ligand/Ion	GLYCEROL
2	MG	4	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	GOL	2	Ligand/Ion	GLYCEROL
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	GOL	2	Ligand/Ion	GLYCEROL
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:9 , ASP A:11 , ASP A:215 , SER A:216 , HOH A:926 , HOH A:946 , HOH A:949	BINDING SITE FOR RESIDUE MG A 800
02	AC2	SOFTWARE	ASP B:9 , ASP B:11 , ASP B:215 , SER B:216 , HOH B:828 , HOH B:858	BINDING SITE FOR RESIDUE MG B 801
03	AC3	SOFTWARE	ASP D:9 , ASP D:11 , ASP D:215 , SER D:216 , HOH D:972 , HOH D:976	BINDING SITE FOR RESIDUE MG D 802
04	AC4	SOFTWARE	ASP C:9 , ASP C:11 , ASP C:215 , SER C:216 , HOH C:832 , HOH C:912	BINDING SITE FOR RESIDUE MG C 803
05	AC5	SOFTWARE	GLY A:45 , ASN A:46 , MET A:126 , HIS A:129 , TYR A:130 , SER A:150 , SER A:178 , ASP A:184	BINDING SITE FOR RESIDUE GOL A 804
06	AC6	SOFTWARE	LYS A:19 , LEU A:125 , LYS A:128 , HIS A:129 , HOH A:904 , HOH A:944 , HOH A:947 , HOH A:950	BINDING SITE FOR RESIDUE GOL A 806
07	AC7	SOFTWARE	GLY B:45 , ASN B:46 , ASN B:68 , TYR B:130 , SER B:150 , SER B:178 , ASP B:184	BINDING SITE FOR RESIDUE GOL B 807
08	AC8	SOFTWARE	GLY C:45 , HIS C:129 , TYR C:130 , SER C:150 , SER C:178 , ASP C:184 , GOL C:809	BINDING SITE FOR RESIDUE GOL C 808
09	AC9	SOFTWARE	ASP C:9 , MET C:10 , ASP C:11 , SER C:44 , GLY C:45 , ASN C:46 , LYS C:192 , ASN C:218 , GOL C:808	BINDING SITE FOR RESIDUE GOL C 809
10	BC1	SOFTWARE	GLY D:45 , MET D:126 , TYR D:130 , SER D:150 , SER D:178 , ASP D:184 , HOH D:914	BINDING SITE FOR RESIDUE GOL D 810

(no "SS Bond" information available for 1RLM)

Asymmetric Unit

No.	Residues
1	Tyr A:267	-	Pro A:268
2	Tyr B:267	-	Pro B:268
3	Tyr D:267	-	Pro D:268

(no "SAP(SNP)/Variant" information available for 1RLM)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	COF_2	PS01229	Hypothetical cof family signature 2.	SUPH_ECOLI	213-235	4	A:213-235 B:213-235 C:213-235 D:213-235

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	COF_2	PS01229	Hypothetical cof family signature 2.	SUPH_ECOLI	213-235	1	A:213-235 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	COF_2	PS01229	Hypothetical cof family signature 2.	SUPH_ECOLI	213-235	1	- B:213-235 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	COF_2	PS01229	Hypothetical cof family signature 2.	SUPH_ECOLI	213-235	1	- - C:213-235 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	COF_2	PS01229	Hypothetical cof family signature 2.	SUPH_ECOLI	213-235	1	- - - D:213-235

(no "Exon" information available for 1RLM)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:269
 aligned with SUPH_ECOLI | P75792 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:269
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261         
           SUPH_ECOLI     2 SVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN 270
               SCOP domains d1rlma_ A: Sugar phosphatase SupH (YbiV)                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1rlmA01 A:2-82,A:190-270  [code=3.40.50.1000, no name defined]                   1rlmA02 A:83-189  [code=3.30.1240.10, no name defined]                                                     1rlmA01 A:2-82,A:190-270  [code=3.40.50.1000, no name defined]                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.............hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh.......eeeehhh.eeee..eeeee...hhhhhhhhhhhhhh....eeeeee...eeee...hhhhhhhhhh....eeee.hhhhh...eeeeeee.hhhhhhhhhhhhhhhh....eeee....eeeee....hhhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhh.eeee....hhhhhhhh.ee..hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COF_2  PDB: A:213-235  ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rlm A   2 AVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTYPFN 270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Chain B from PDB  Type:PROTEIN  Length:269
 aligned with SUPH_ECOLI | P75792 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:269
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261         
           SUPH_ECOLI     2 SVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN 270
               SCOP domains d1rlmb_ B: Sugar phosphatase SupH (YbiV)                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1rlmB01 B:2-82,B:190-270  [code=3.40.50.1000, no name defined]                   1rlmB02 B:83-189  [code=3.30.1240.10, no name defined]                                                     1rlmB01 B:2-82,B:190-270  [code=3.40.50.1000, no name defined]                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.............hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh.......eeeehhh.eeee..eeeee...hhhhhhhhhhhhhh....eeeeee...eeee...hhhhhhhhhh....eeee.hhhhh...eeeeeee....hhhhhhhhhhhhh....eeee....eeeee....hhhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhh.eeee....hhhhhhhh.ee..hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COF_2  PDB: B:213-235  ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rlm B   2 AVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTYPFN 270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Chain C from PDB  Type:PROTEIN  Length:269
 aligned with SUPH_ECOLI | P75792 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:269
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261         
           SUPH_ECOLI     2 SVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN 270
               SCOP domains d1rlmc_ C: Sugar phosphatase SupH (YbiV)                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1rlmC01 C:2-82,C:190-270  [code=3.40.50.1000, no name defined]                   1rlmC02 C:83-189  [code=3.30.1240.10, no name defined]                                                     1rlmC01 C:2-82,C:190-270  [code=3.40.50.1000, no name defined]                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.............hhhhhhhhhhhhhhh..eeeee...hhhhhhhhh.......eeeehhh.eeee..eeeee...hhhhhhhhhhhhhh....eeeeee...eeee...hhhhhhhhhh....eeee.hhhhh...eeeeeee....hhhhhhhhhhhhhh...eeee....eeeee....hhhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhh.eeee....hhhhhhhh.ee..hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COF_2  PDB: C:213-235  ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rlm C   2 AVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTYPFN 270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Chain D from PDB  Type:PROTEIN  Length:269
 aligned with SUPH_ECOLI | P75792 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:269
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261         
           SUPH_ECOLI     2 SVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN 270
               SCOP domains d1rlmd_ D: Sugar phosphatase SupH (YbiV)                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1rlmD01 D:2-82,D:190-270  [code=3.40.50.1000, no name defined]                   1rlmD02 D:83-189  [code=3.30.1240.10, no name defined]                                                     1rlmD01 D:2-82,D:190-270  [code=3.40.50.1000, no name defined]                    CATH domains
           Pfam domains (1) ----Hydrolase_3-1rlmD01 D:6-259                                                                                                                                                                                                                                   ----------- Pfam domains (1)
           Pfam domains (2) ----Hydrolase_3-1rlmD02 D:6-259                                                                                                                                                                                                                                   ----------- Pfam domains (2)
           Pfam domains (3) ----Hydrolase_3-1rlmD03 D:6-259                                                                                                                                                                                                                                   ----------- Pfam domains (3)
           Pfam domains (4) ----Hydrolase_3-1rlmD04 D:6-259                                                                                                                                                                                                                                   ----------- Pfam domains (4)
         Sec.struct. author ...eeee.............hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh.......eeeehhh.eeee..eeeee...hhhhhhhhhhhhh.....eeeeee...eeee...hhhhhhhhhh....eeee.hhhhh...eeeeeee.hhhhhhhhhhhhhhhh....eeee....eeeee....hhhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhh.eeee....hhhhhhhh.ee......hhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COF_2  PDB: D:213-235  ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rlm D   2 AVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTYPFN 270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: HAD-like (349)

Superfamily: HAD-like (349)

Family: Predicted hydrolases Cof (35)

Protein domain: Sugar phosphatase SupH (YbiV) (3)

Escherichia coli [TaxId: 562] (3)

1a	d1rlma_	A:
1b	d1rlmb_	B:
1c	d1rlmc_	C:
1d	d1rlmd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 (8)

Homologous Superfamily: [code=3.30.1240.10, no name defined] (8)

Escherichia coli. Organism_taxid: 562. (4)

1a	1rlmA02	A:83-189
1b	1rlmB02	B:83-189
1c	1rlmC02	C:83-189
1d	1rlmD02	D:83-189

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.1000, no name defined] (211)

Escherichia coli. Organism_taxid: 562. (14)

2a	1rlmA01	A:2-82,A:190-270
2b	1rlmB01	B:2-82,B:190-270
2c	1rlmC01	C:2-82,C:190-270
2d	1rlmD01	D:2-82,D:190-270

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: HAD (186)

Family: Hydrolase_3 (28)

Escherichia coli (strain K12) (4)

1a	Hydrolase_3-1rlmD01	D:6-259
1b	Hydrolase_3-1rlmD02	D:6-259
1c	Hydrolase_3-1rlmD03	D:6-259
1d	Hydrolase_3-1rlmD04	D:6-259

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (SUPH_ECOLI | P75792)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0050308	sugar-phosphatase activity	Catalysis of the reaction: sugar phosphate + H2O = sugar + phosphate.
biological process
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0044283	small molecule biosynthetic process	The chemical reactions and pathways resulting in the formation of small molecules, any low molecular weight, monomeric, non-encoded molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr A:267 - Pro A:268	[ RasMol ]
		Tyr B:267 - Pro B:268	[ RasMol ]
		Tyr D:267 - Pro D:268	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1rlm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SUPH_ECOLI \| P75792
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SUPH_ECOLI \| P75792
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SUPH_ECOLI \| P75792	:	1rlo 1rlt 2hf2

1rlo	CRYSTAL STRUCTURE OF BERYLLOFLUORIDE-BOUND YBIV
1rlt	CRYSTAL STRUCTURE OF TRANSITION STATE ANALOGUE OF YBIV

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (2, 8)

Pfam Domains (1, 4)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File