Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF 2FE2S FERREDOXIN FROM THERMOPHILIC CYANOBACTERIUM MASTIGOCLADUS LAMINOSUS
 
Authors :  A. Fish, R. Nechushtai, O. Livnah
Date :  10 Nov 03  (Deposition) - 12 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.25
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Ferredoxin, Thermostability, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Fish, T. Danieli, I. Ohad, R. Nechushtai, O. Livnah
Structural Basis For The Thermostability Of Ferredoxin From The Cyanobacterium Mastigocladus Laminosus.
J. Mol. Biol. V. 350 599 2005
PubMed-ID: 15961101  |  Reference-DOI: 10.1016/J.JMB.2005.04.071
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FERREDOXIN
    Chains: A, B
    Organism Scientific: MASTIGOCLADUS LAMINOSUS
    Organism Taxid: 83541

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:40 , CYS A:41 , ARG A:42 , GLY A:44 , ALA A:45 , CYS A:46 , CYS A:49 , LEU A:77 , CYS A:79BINDING SITE FOR RESIDUE FES A 100
2AC2SOFTWARESER B:240 , CYS B:241 , ARG B:242 , GLY B:244 , ALA B:245 , CYS B:246 , CYS B:249 , CYS B:279BINDING SITE FOR RESIDUE FES B 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RFK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1RFK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RFK)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FER_MASLA4-96
 		  2A:3-95
B:203-295
22FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FER_MASLA42-50
 		  2A:41-49
B:241-249
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FER_MASLA4-96
 		  1A:3-95
-
22FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FER_MASLA42-50
 		  1A:41-49
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FER_MASLA4-96
 		  1-
B:203-295
22FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FER_MASLA42-50
 		  1-
B:241-249

(-) Exons   (0, 0)

(no "Exon" information available for 1RFK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with FER_MASLA | P00248 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
            FER_MASLA     2 ATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEELY  99
               SCOP domains d1rfka_ A   : automated matches                                                                    SCOP domains
               CATH domains 1rfkA00 A   :1-98  [code=3.10.20.30, no name defined]                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.---..eeeeeee...hhhhhhhhh................eeeeee..ee.......hhhhhhh.eee.hhhee...eeee..hhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --2FE2S_FER_2  PDB: A:3-95 UniProt: 4-96                                                       --- PROSITE (1)
                PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 1rfk A   1 ATYKVTLIN---GLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEELY  98
                                    |-  |     20        30        40        50        60        70        80        90        
                                    9  13                                                                                     


Chain B from PDB  Type:PROTEIN  Length:97
 aligned with FER_MASLA | P00248 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:97
                                    11        21        31        41        51        61        71        81        91       
            FER_MASLA     2 ATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL  98
               SCOP domains d1rfkb_ B: automated matches                                                                      SCOP domains
               CATH domains 1rfkB00 B:201-297  [code=3.10.20.30, no name defined]                                             CATH domains
           Pfam domains (1) --------Fer2-1rfkB01 B:209-284                                                      ------------- Pfam domains (1)
           Pfam domains (2) --------Fer2-1rfkB02 B:209-284                                                      ------------- Pfam domains (2)
         Sec.struct. author .eeeeeeeehhhheeeeeeee...hhhhhhhhh................eeeeee..ee.......hhhhhhhheee.hhhee...eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --2FE2S_FER_2  PDB: B:203-295 UniProt: 4-96                                                    -- PROSITE (1)
                PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 1rfk B 201 ATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL 297
                                   210       220       230       240       250       260       270       280       290
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Fer2 (69)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (FER_MASLA | P00248)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0022900    electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1rfk)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rfk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FER_MASLA | P00248
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FER_MASLA | P00248
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FER_MASLA | P00248: 3p63

(-) Related Entries Specified in the PDB File

1a70 1off 1qt9 4fxc