Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE AND FUNCTION OF YBDK
 
Authors :  C. Lehmann, V. Doseeva, S. Pullalarevu, W. Krajewski, A. Howard, O. Herzberg, Structure 2 Function Project (S2F)
Date :  24 Oct 03  (Deposition) - 17 Aug 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Unknown Function, Ybdk, Hypothetical Protein, Carboxylate-Amine Ligase, Structure 2 Function Project, S2F (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Lehmann, V. Doseeva, S. Pullalarevu, W. Krajewski, A. Howard, O. Herzberg
Ybdk Is A Carboxylate-Amine Ligase With A Gamma-Glutamyl:Cysteine Ligase Activity: Crystal Structure And Enzymatic Assays
Proteins: V. 56 376 2004 Struct. , Funct. , Genet.
PubMed-ID: 15211520  |  Reference-DOI: 10.1002/PROT.20103
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN YBDK
    ChainsA, B
    EC Number6.3.-.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET100-D-TOPO
    Expression System StrainBL21STAR(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneYBDK, B0581
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 20)

Asymmetric/Biological Unit (1, 20)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1R8G)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1R8G)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Pro A:25 -Pro A:26
2Pro B:25 -Pro B:26

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R8G)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R8G)

(-) Exons   (0, 0)

(no "Exon" information available for 1R8G)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:352
 aligned with GCS2_ECOLI | P77213 from UniProtKB/Swiss-Prot  Length:372

    Alignment length:368
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362        
           GCS2_ECOLI     3 LPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKITAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGSLIGLVKKHCEIWA 370
               SCOP domains d1r8ga_ A: Carboxylate-amine ligase YbdK                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeeeeeee....ee...hhhhhh.........eeee.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhh..eee..........----------------.hhhhhh.....eeeeeee..hhhhhhhhhhhhhhhhhhhhhhhh...ee..ee.....hhhhhhh............hhhhhhhhhhhhh......hhhhh...eeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...eee......eeehhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r8g A   3 LPDFHVSEPFTLGIELEmQVVNPPGYDLSQDSSmLIDAVKNKITAGEVKHDITESmLELATDVCRDINQAAGQFSAmQKVVLQAATDHHLEICGGGTHPFQKW----------------NFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYmQGTDTRFASSRPNIFSAFPDNGPmPWVSNWQQFEALFRCLSYTTmIDSIKDLHWDIRPSPHFGTVEVRVmDTPLTLSHAVNmAGLIQATAHWLLTERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLmRDFVADGGSLIGLVKKHCEIWA 370
                                    12       |22        32   |    42        52     |  62        72      | 82        92       102  |      -       122       132       142       152       162       172       182       192  |    202       212   |   222       232       242       252|      262       272       282       292       302       312       322       332       342     | 352       362        
                                            20-MSE          36-MSE                58-MSE               79-MSE                   105              122                                              171-MSE                 195-MSE              216-MSE                  241-MSE     253-MSE                                                                                        348-MSE                  

Chain B from PDB  Type:PROTEIN  Length:358
 aligned with GCS2_ECOLI | P77213 from UniProtKB/Swiss-Prot  Length:372

    Alignment length:369
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361         
           GCS2_ECOLI     2 PLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKITAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGSLIGLVKKHCEIWA 370
               SCOP domains d1r8gb_ B: Carboxylate-amine ligase YbdK                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeeeeeeee....ee..hhhhhhhhhh......eee.-....eeeee.....hhhhhhhhhhhhhhhhhhhhhhh..eee...........----------.hhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhhhhhhhhhhh...ee..ee.....hhhhh..............hhhhhhhhhhhhh......hhhhh...eeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...eee......eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r8g B   2 PLPDFHVSEPFTLGIELEmQVVNPPGYDLSQDSSmLIDAVKNKITAGEVKH-ITESmLELATDVCRDINQAAGQFSAmQKVVLQAATDHHLEICGGGTHPFQKWQ----------QRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYmQGTDTRFASSRPNIFSAFPDNGPmPWVSNWQQFEALFRCLSYTTmIDSIKDLHWDIRPSPHFGTVEVRVmDTPLTLSHAVNmAGLIQATAHWLLTERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLmRDFVADGGSLIGLVKKHCEIWA 370
                                    11        21        31    |   41        51| |   | 61        71       |81        91       101    |    -     | 121       131       141       151       161       171       181       191   |   201       211    |  221       231       241       251 |     261       271       281       291       301       311       321       331       341      |351       361         
                                             20-MSE          36-MSE          52 |   |                   79-MSE                    106        117                                                   171-MSE                 195-MSE              216-MSE                  241-MSE     253-MSE                                                                                        348-MSE                  
                                                                               54   |                                                                                                                                                                                                                                                                                                                        
                                                                                   58-MSE                                                                                                                                                                                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1R8G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1R8G)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GCS2_ECOLI | P77213)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004357    glutamate-cysteine ligase activity    Catalysis of the reaction: L-cysteine + L-glutamate + ATP = L-gamma-glutamyl-L-cysteine + ADP + 2 H(+) + phosphate.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0016879    ligase activity, forming carbon-nitrogen bonds    Catalysis of the joining of two molecules, or two groups within a single molecule, via a carbon-nitrogen bond, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0042398    cellular modified amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of compounds derived from amino acids, organic acids containing one or more amino substituents.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1r8g)
 
  Cis Peptide Bonds
    Pro A:25 - Pro A:26   [ RasMol ]  
    Pro B:25 - Pro B:26   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r8g
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GCS2_ECOLI | P77213
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.-.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GCS2_ECOLI | P77213
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R8G)

(-) Related Entries Specified in the PDB File

ybdk