|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1R5P) |
(no "Site" information available for 1R5P) |
(no "SS Bond" information available for 1R5P) |
(no "Cis Peptide Bond" information available for 1R5P) |
(no "SAP(SNP)/Variant" information available for 1R5P) |
(no "PROSITE Motif" information available for 1R5P) |
(no "Exon" information available for 1R5P) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:90 aligned with KAIB_NOSS1 | Q8YT41 from UniProtKB/Swiss-Prot Length:108 Alignment length:90 16 26 36 46 56 66 76 86 96 KAIB_NOSS1 7 TYVLKLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKILATPTLSKILPPPVRKIIGDLSDRERVLIGLDLLYEE 96 SCOP domains d1r5pa_ A: Circadian oscillation regulator KaiB SCOP domains CATH domains 1r5pA00 A:7-96 Glutaredoxin CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1r5p A 7 TYVLKLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKILATPTLSKILPPPVRKIIGDLSDRERVLIGLDLLYEE 96 16 26 36 46 56 66 76 86 96 Chain B from PDB Type:PROTEIN Length:93 aligned with KAIB_NOSS1 | Q8YT41 from UniProtKB/Swiss-Prot Length:108 Alignment length:93 15 25 35 45 55 65 75 85 95 KAIB_NOSS1 6 KTYVLKLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKILATPTLSKILPPPVRKIIGDLSDRERVLIGLDLLYEELT 98 SCOP domains d1r5pb_ B: Circadian oscillation regulator KaiB SCOP domains CATH domains 1r5pB00 B:1006-1098 Glutaredoxin CATH domains Pfam domains (1) -----KaiB-1r5pB01 B:1011-1092 ------ Pfam domains (1) Pfam domains (2) -----KaiB-1r5pB02 B:1011-1092 ------ Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1r5p B 1006 KTYVLKLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKILATPTLSKILPPPVRKIIGDLSDRERVLIGLDLLYEELT 1098 1015 1025 1035 1045 1055 1065 1075 1085 1095
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain A,B (KAIB_NOSS1 | Q8YT41)
|
|
|
|
|
|
|