Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF KAI A FROM PCC7120
 
Authors :  R. G. Garces, N. Wu, W. Gillon, E. F. Pai
Date :  12 Oct 03  (Deposition) - 04 May 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Four-Helix-Bundle, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. G. Garces, N. Wu, W. Gillon, E. F. Pai
Anabaena Circadian Clock Proteins Kaia And Kaib Reveal A Potential Common Binding Site To Their Partner Kaic
Embo J. V. 23 1688 2004
PubMed-ID: 15071498  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600190

(-) Compounds

Molecule 1 - CIRCADIAN OSCILLATION REGULATOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET32
    Expression System StrainBL 21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneKAI A
    Organism ScientificNOSTOC SP.
    Organism Taxid103690
    StrainPCC 7120
    SynonymKAI A

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1R5Q)

(-) Sites  (0, 0)

(no "Site" information available for 1R5Q)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:93 -A:93

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1R5Q)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R5Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R5Q)

(-) Exons   (0, 0)

(no "Exon" information available for 1R5Q)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with KAIA_NOSS1 | Q8YT42 from UniProtKB/Swiss-Prot  Length:102

    Alignment length:98
                                    13        23        33        43        53        63        73        83        93        
           KAIA_NOSS1     4 EVDQQILLQQLKSDYRQILLSYFTTDKALKEKIDKFINAVFCANIPVPEIIEIHMELIDEFSKQLRLEGRGDETLMDYRLTLIDILAHLCEAYRGAIF 101
               SCOP domains d1r5qa_ A: Circadian clock   protein KaiA, C-terminal domain                                       SCOP domains
               CATH domains 1r5qA00 A:4-101 KaiA/RbsU   domain                                                                 CATH domains
               Pfam domains KaiA-1r5qA01 A:4-101                                                                               Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh....--hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..---..--hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 1r5q A   4 EVDQQILLQQLKSDYRQILLSYFTTD--LKEKIDKFINAVFCANIPVPEIIEIHMELIDEFSKQLRL---GD--LMDYRLTLIDILAHLCEAYRGAIF 101
                                    13        23     |  33        43        53        63      |  -||  |   83        93        
                                                    29 32                                    70  74| 78                       
                                                                                                  75                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (KAIA_NOSS1 | Q8YT42)
biological process
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1r5q)
 
  Sites
(no "Sites" information available for 1r5q)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r5q)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r5q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAIA_NOSS1 | Q8YT42
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAIA_NOSS1 | Q8YT42
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R5Q)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R5Q)