Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE FOLDED CORE OF PSEUDOMONAS SYRINGAE EFFECTOR PROTEIN, AVRPTO
 
Authors :  J. Wulf, P. E. Pascuzzi, G. B. Martin, L. K. Nicholson
Date :  10 Oct 03  (Deposition) - 19 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
Keywords :  Three-Helix Bundle, Omega Loop, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Wulf, P. E. Pascuzzi, A. Fahmy, G. B. Martin, L. K. Nicholson
The Solution Structure Of Type Iii Effector Protein Avrpto Reveals Conformational And Dynamic Features Important For Plant Pathogenesis.
Structure V. 12 1257 2004
PubMed-ID: 15242602  |  Reference-DOI: 10.1016/J.STR.2004.04.017
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AVIRULENCE PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPFLAG-CTC
    Expression System StrainBL21-GOLD
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentTRAVRPTO (RESIDUES 29-133)
    Organism ScientificPSEUDOMONAS SYRINGAE
    Organism Taxid317

 Structural Features

(-) Chains, Units

  
NMR Structure (30x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1R5E)

(-) Sites  (0, 0)

(no "Site" information available for 1R5E)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1R5E)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1R5E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R5E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R5E)

(-) Exons   (0, 0)

(no "Exon" information available for 1R5E)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:105
 aligned with Q08242_PSESX | Q08242 from UniProtKB/TrEMBL  Length:164

    Alignment length:105
                                    38        48        58        68        78        88        98       108       118       128     
         Q08242_PSESX    29 DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADI 133
               SCOP domains d1r5ea_ A: Avirulence protein AvrPto                                                                      SCOP domains
               CATH domains 1r5eA01 A:29-129 Avirulence protein AvrPto                                                           ---- CATH domains
               Pfam domains AvrPto-1r5eA01 A:29-133                                                                                   Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh...hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 1r5e A  29 DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADI 133
                                    38        48        58        68        78        88        98       108       118       128     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1R5E)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1r5e)
 
  Sites
(no "Sites" information available for 1r5e)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r5e)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r5e
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q08242_PSESX | Q08242
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q08242_PSESX | Q08242
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q08242_PSESX | Q082422qkw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R5E)