1QQR - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF STREPTOKINASE DOMAIN B

Authors :   G. Spraggon, X. X. Zhang, C. P. Ponting, V. F. Fox, C. Phillips, R. A. G. Smith, E. Y. Jones, C. Dobson, D. I. Stuart

Date :   07 Jun 99 (Deposition) - 17 Jun 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Non-Proteolytic, Plasminogen Activation, Fibrinolysis, Hydrolase Activator (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Spraggon, X. X. Zhang, C. P. Ponting, V. F. Fox, C. Phillips, R. A. G. Smith, E. Y. Jones, C. Dobson, D. I. Stuart
Crystal Structure Of Streptokinse Domain B
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - STREPTOKINASE DOMAIN B
	Chains	:	A, B, C, D
	Fragment	:	B-DOMAIN
	Organism Scientific	:	STREPTOCOCCUS DYSGALACTIAE SUBSP. EQUISIMILIS
	Organism Taxid	:	119602
	Strain	:	SUBSP. EQUISIMILIS

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1QQR)

(no "Site" information available for 1QQR)

(no "SS Bond" information available for 1QQR)

(no "Cis Peptide Bond" information available for 1QQR)

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STRP_STREQ_001 *	L	195	D	STRP_STREQ	---	---	A/B/C/D	L	169	D
2	UniProt	VAR_STRP_STREQ_002 *	D	207	L	STRP_STREQ	---	---	A/B/C/D	L	181	L
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STRP_STREQ_001 *	L	195	D	STRP_STREQ	---	---	A	L	169	D
2	UniProt	VAR_STRP_STREQ_002 *	D	207	L	STRP_STREQ	---	---	A	L	181	L
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STRP_STREQ_001 *	L	195	D	STRP_STREQ	---	---	B	L	169	D
2	UniProt	VAR_STRP_STREQ_002 *	D	207	L	STRP_STREQ	---	---	B	L	181	L
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STRP_STREQ_001 *	L	195	D	STRP_STREQ	---	---	C	L	169	D
2	UniProt	VAR_STRP_STREQ_002 *	D	207	L	STRP_STREQ	---	---	C	L	181	L
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STRP_STREQ_001 *	L	195	D	STRP_STREQ	---	---	D	L	169	D
2	UniProt	VAR_STRP_STREQ_002 *	D	207	L	STRP_STREQ	---	---	D	L	181	L
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1QQR)

(no "Exon" information available for 1QQR)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqra_ A: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrA00 A:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr A 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280

Chain B from PDB  Type:PROTEIN  Length:133
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:133
                                   186       196       206       216       226       236       246       256       266       276       286       296       306   
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKP 309
               SCOP domains d1qqrb_ B: Streptokinase                                                                                                              SCOP domains
               CATH domains 1qqrB00 B:151-283  [code=3.10.20.180, no name defined]                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qqr B 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKP 283
                                   160       170       180       190       200       210       220       230       240       250       260       270       280

Chain C from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqrc_ C: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrC00 C:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......eee......eee.......eee......eee..eeeeeeeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr C 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280

Chain D from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqrd_ D: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrD00 D:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (4)
           Pfam domains (5) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (5)
           Pfam domains (6) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (6)
           Pfam domains (7) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (7)
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee.....hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr D 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: beta-Grasp (ubiquitin-like) (1032)

Superfamily: Staphylokinase/streptokinase (12)

Family: Staphylokinase/streptokinase (12)

Protein domain: Streptokinase (5)

Streptococcus equisimilis [TaxId: 119602] (5)

1a	d1qqra_	A:
1b	d1qqrb_	B:
1c	d1qqrc_	C:
1d	d1qqrd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Roll (3276)

Topology: Ubiquitin-like (UB roll) (674)

Homologous Superfamily: [code=3.10.20.180, no name defined] (5)

Equisimilis (Streptococcus dysgalactiae subsp) (2)

1a	1qqrB00	B:151-283
1b	1qqrA00	A:151-288
1c	1qqrC00	C:151-288
1d	1qqrD00	D:151-288

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (STRP_STREQ | P00779)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0031639	plasminogen activation	The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qqr)

	Sites
(no "Sites" information available for 1qqr)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qqr)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qqr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	STRP_STREQ \| P00779
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	STRP_STREQ \| P00779
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	STRP_STREQ \| P00779	:	1bml 1l4d 1l4z

(no "Related Entries Specified in the PDB File" available for 1QQR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 7)

Gene Ontology (4, 4)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File