Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STREPTOKINASE DOMAIN B
 
Authors :  G. Spraggon, X. X. Zhang, C. P. Ponting, V. F. Fox, C. Phillips, R. A. G. Smith, E. Y. Jones, C. Dobson, D. I. Stuart
Date :  07 Jun 99  (Deposition) - 17 Jun 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Non-Proteolytic, Plasminogen Activation, Fibrinolysis, Hydrolase Activator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Spraggon, X. X. Zhang, C. P. Ponting, V. F. Fox, C. Phillips, R. A. G. Smith, E. Y. Jones, C. Dobson, D. I. Stuart
Crystal Structure Of Streptokinse Domain B
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - STREPTOKINASE DOMAIN B
    ChainsA, B, C, D
    FragmentB-DOMAIN
    Organism ScientificSTREPTOCOCCUS DYSGALACTIAE SUBSP. EQUISIMILIS
    Organism Taxid119602
    StrainSUBSP. EQUISIMILIS

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1QQR)

(-) Sites  (0, 0)

(no "Site" information available for 1QQR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QQR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QQR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 8)

Asymmetric Unit (2, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRP_STREQ_001 *L195DSTRP_STREQ  ---  ---A/B/C/DL169D
2UniProtVAR_STRP_STREQ_002 *D207LSTRP_STREQ  ---  ---A/B/C/DL181L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRP_STREQ_001 *L195DSTRP_STREQ  ---  ---AL169D
2UniProtVAR_STRP_STREQ_002 *D207LSTRP_STREQ  ---  ---AL181L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRP_STREQ_001 *L195DSTRP_STREQ  ---  ---BL169D
2UniProtVAR_STRP_STREQ_002 *D207LSTRP_STREQ  ---  ---BL181L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRP_STREQ_001 *L195DSTRP_STREQ  ---  ---CL169D
2UniProtVAR_STRP_STREQ_002 *D207LSTRP_STREQ  ---  ---CL181L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRP_STREQ_001 *L195DSTRP_STREQ  ---  ---DL169D
2UniProtVAR_STRP_STREQ_002 *D207LSTRP_STREQ  ---  ---DL181L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QQR)

(-) Exons   (0, 0)

(no "Exon" information available for 1QQR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqra_ A: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrA00 A:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr A 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280        

Chain B from PDB  Type:PROTEIN  Length:133
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:133
                                   186       196       206       216       226       236       246       256       266       276       286       296       306   
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKP 309
               SCOP domains d1qqrb_ B: Streptokinase                                                                                                              SCOP domains
               CATH domains 1qqrB00 B:151-283  [code=3.10.20.180, no name defined]                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qqr B 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKP 283
                                   160       170       180       190       200       210       220       230       240       250       260       270       280   

Chain C from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqrc_ C: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrC00 C:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......eee......eee.......eee......eee..eeeeeeeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr C 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280        

Chain D from PDB  Type:PROTEIN  Length:138
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:138
                                   186       196       206       216       226       236       246       256       266       276       286       296       306        
           STRP_STREQ   177 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 314
               SCOP domains d1qqrd_ D: Streptokinase                                                                                                                   SCOP domains
               CATH domains 1qqrD00 D:151-288  [code=3.10.20.180, no name defined]                                                                                     CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (4)
           Pfam domains (5) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (5)
           Pfam domains (6) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (6)
           Pfam domains (7) -----------------------------------------------------------------------------------------------------------------------------------Staphyl Pfam domains (7)
         Sec.struct. author .......eeeeeeeeeee..............eeeeee....eeehhhhhhhhhhhhhhhh..eeeeeeeeeeeee......ee.......eee.......eee......eee..eeeeeeeeeeeee.....hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------D-----------L----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qqr D 151 IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD 288
                                   160       170       180       190       200       210       220       230       240       250       260       270       280        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 7)

Asymmetric Unit

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (STRP_STREQ | P00779)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qqr)
 
  Sites
(no "Sites" information available for 1qqr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qqr)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qqr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  STRP_STREQ | P00779
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  STRP_STREQ | P00779
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        STRP_STREQ | P007791bml 1l4d 1l4z

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QQR)