1QMA - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_HUMAN | P61970 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
           NTF2_HUMAN     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmaa_ A: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaA00 A:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) --------NTF2_DOMAIN  PDB: A:10-121 UniProt: 10-121                                                                      ------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qma A   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain A from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_MOUSE | P61971 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
           NTF2_MOUSE     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmaa_ A: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaA00 A:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------NTF2_DOMAIN  PDB: A:10-121 UniProt: 10-121                                                                      ------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qma A   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain A from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_RAT | P61972 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
             NTF2_RAT     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmaa_ A: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaA00 A:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------NTF2_DOMAIN  PDB: A:10-121 UniProt: 10-121                                                                      ------ PROSITE (3)
               Transcript 1 Exon 1.2  PDB: A:2-33           Exon 1.3  PDB: A:34-57  Exon 1.4  PDB: A:58-90           Exon 1.5  PDB: A:91-127               Transcript 1
                 1qma A   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_HUMAN | P61970 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
           NTF2_HUMAN     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmab_ B: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaB00 B:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------NTF2_DOMAIN  PDB: B:10-121 UniProt: 10-121                                                                      ------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qma B   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_MOUSE | P61971 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
           NTF2_MOUSE     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmab_ B: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaB00 B:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------NTF2_DOMAIN  PDB: B:10-121 UniProt: 10-121                                                                      ------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qma B   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_RAT | P61972 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
             NTF2_RAT     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmab_ B: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaB00 B:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------NTF2_DOMAIN  PDB: B:10-121 UniProt: 10-121                                                                      ------ PROSITE (3)
               Transcript 1 Exon 1.2  PDB: B:4-33         Exon 1.3  PDB: B:34-57  Exon 1.4  PDB: B:58-90           Exon 1.5  PDB: B:91-127               Transcript 1
                 1qma B   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain C from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_HUMAN | P61970 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
           NTF2_HUMAN     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmac_ C: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaC00 C:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) --------NTF2_DOMAIN  PDB: C:10-121 UniProt: 10-121                                                                      ------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qma C   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain C from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_MOUSE | P61971 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
           NTF2_MOUSE     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmac_ C: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaC00 C:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------NTF2_DOMAIN  PDB: C:10-121 UniProt: 10-121                                                                      ------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qma C   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain C from PDB  Type:PROTEIN  Length:126
 aligned with NTF2_RAT | P61972 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:126
                                    11        21        31        41        51        61        71        81        91       101       111       121      
             NTF2_RAT     2 GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmac_ C: Nuclear transport factor-2 (NTF2)                                                                                   SCOP domains
               CATH domains 1qmaC00 C:2-127  [code=3.10.450.50, no name defined]                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee....eeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------NTF2_DOMAIN  PDB: C:10-121 UniProt: 10-121                                                                      ------ PROSITE (3)
               Transcript 1 Exon 1.2  PDB: C:2-33           Exon 1.3  PDB: C:34-57  Exon 1.4  PDB: C:58-90           Exon 1.5  PDB: C:91-127               Transcript 1
                 1qma C   2 GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    11        21        31        41        51        61        71        81        91       101       111       121

Chain D from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_HUMAN | P61970 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
           NTF2_HUMAN     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmad_ D: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaD00 D:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
           Pfam domains (1) ------NTF2-1qmaD01 D:10-121                                                                                           ------ Pfam domains (1)
           Pfam domains (2) ------NTF2-1qmaD02 D:10-121                                                                                           ------ Pfam domains (2)
           Pfam domains (3) ------NTF2-1qmaD03 D:10-121                                                                                           ------ Pfam domains (3)
           Pfam domains (4) ------NTF2-1qmaD04 D:10-121                                                                                           ------ Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------NTF2_DOMAIN  PDB: D:10-121 UniProt: 10-121                                                                      ------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qma D   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain D from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_MOUSE | P61971 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
           NTF2_MOUSE     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmad_ D: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaD00 D:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
           Pfam domains (1) ------NTF2-1qmaD01 D:10-121                                                                                           ------ Pfam domains (1)
           Pfam domains (2) ------NTF2-1qmaD02 D:10-121                                                                                           ------ Pfam domains (2)
           Pfam domains (3) ------NTF2-1qmaD03 D:10-121                                                                                           ------ Pfam domains (3)
           Pfam domains (4) ------NTF2-1qmaD04 D:10-121                                                                                           ------ Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------NTF2_DOMAIN  PDB: D:10-121 UniProt: 10-121                                                                      ------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qma D   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain D from PDB  Type:PROTEIN  Length:124
 aligned with NTF2_RAT | P61972 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
             NTF2_RAT     4 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
               SCOP domains d1qmad_ D: Nuclear transport factor-2 (NTF2)                                                                                 SCOP domains
               CATH domains 1qmaD00 D:4-127  [code=3.10.450.50, no name defined]                                                                         CATH domains
           Pfam domains (1) ------NTF2-1qmaD01 D:10-121                                                                                           ------ Pfam domains (1)
           Pfam domains (2) ------NTF2-1qmaD02 D:10-121                                                                                           ------ Pfam domains (2)
           Pfam domains (3) ------NTF2-1qmaD03 D:10-121                                                                                           ------ Pfam domains (3)
           Pfam domains (4) ------NTF2-1qmaD04 D:10-121                                                                                           ------ Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhh......eeee..eeeehhhhhhhhhhh.....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------NTF2_DOMAIN  PDB: D:10-121 UniProt: 10-121                                                                      ------ PROSITE (3)
               Transcript 1 Exon 1.2  PDB: D:4-33         Exon 1.3  PDB: D:34-57  Exon 1.4  PDB: D:58-90           Exon 1.5  PDB: D:91-127               Transcript 1
                 1qma D   4 KPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG 127
                                    13        23        33        43        53        63        73        83        93       103       113       123

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (NTF2_RAT | P61972)

molecular function
	GO:0008536	Ran GTPase binding	Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:1904046	negative regulation of vascular endothelial growth factor production	Any process that stops, prevents or reduces the frequency, rate or extent of vascular endothelial growth factor production.
	GO:0042307	positive regulation of protein import into nucleus	Any process that activates or increases the frequency, rate or extent of movement of proteins from the cytoplasm into the nucleus.
	GO:0006611	protein export from nucleus	The directed movement of a protein from the nucleus into the cytoplasm.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005640	nuclear outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the nuclear envelope; continuous with the endoplasmic reticulum of the cell and sometimes studded with ribosomes.
	GO:0044613	nuclear pore central transport channel	The central substructure of the nuclear pore complex (NPC), through which nucleocytoplasmic transport of RNAs, proteins and small molecules occurs. The central transport channel is filled with FG-nucleoporins, which form a selective barrier and provide a series of binding sites for transporter proteins. Characterized S. cerevisiae FG-nucleoporins include Nup159p, Nup145Np, Nup116p, Nup100p, Nsp1p, Nup57p, Nup49p, Nup42p, Nup53p, Nup59p/Asm4p, Nup60p and Nup1. Characterized vertebrate FG-nucleoporins include Nup214, Nup98, Nup62, Nup54, Nup58/45, NLP1, and Nup153.

Chain A,B,C,D (NTF2_HUMAN | P61970)

molecular function
	GO:0008536	Ran GTPase binding	Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:1904046	negative regulation of vascular endothelial growth factor production	Any process that stops, prevents or reduces the frequency, rate or extent of vascular endothelial growth factor production.
	GO:0042307	positive regulation of protein import into nucleus	Any process that activates or increases the frequency, rate or extent of movement of proteins from the cytoplasm into the nucleus.
	GO:0006611	protein export from nucleus	The directed movement of a protein from the nucleus into the cytoplasm.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005640	nuclear outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the nuclear envelope; continuous with the endoplasmic reticulum of the cell and sometimes studded with ribosomes.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0044613	nuclear pore central transport channel	The central substructure of the nuclear pore complex (NPC), through which nucleocytoplasmic transport of RNAs, proteins and small molecules occurs. The central transport channel is filled with FG-nucleoporins, which form a selective barrier and provide a series of binding sites for transporter proteins. Characterized S. cerevisiae FG-nucleoporins include Nup159p, Nup145Np, Nup116p, Nup100p, Nsp1p, Nup57p, Nup49p, Nup42p, Nup53p, Nup59p/Asm4p, Nup60p and Nup1. Characterized vertebrate FG-nucleoporins include Nup214, Nup98, Nup62, Nup54, Nup58/45, NLP1, and Nup153.

Chain A,B,C,D (NTF2_MOUSE | P61971)

molecular function
	GO:0008536	Ran GTPase binding	Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0006611	protein export from nucleus	The directed movement of a protein from the nucleus into the cytoplasm.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (4, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (18, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File