Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF ANTI-HIV-1 FAB 447-52D IN COMPLEX WITH V3 PEPTIDE
 
Authors :  R. L. Stanfield, M. K. Gorny, C. Williams, S. Zolla-Pazner, I. A. Wilson
Date :  21 Jul 03  (Deposition) - 17 Feb 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  H,I,L,M,P,Q
Keywords :  Fab-Peptide Complex, Hiv-1, Gp120, V3 Loop, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. L. Stanfield, M. K. Gorny, C. Williams, S. Zolla-Pazner, I. A. Wilson
Structural Rationale For The Broad Neutralization Of Hiv-1 By Human Monoclonal Antibody 447-52D.
Structure V. 12 193 2004
PubMed-ID: 14962380  |  Reference-DOI: 10.1016/J.STR.2004.01.003
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FAB 447-52D, LIGHT CHAIN
    ChainsL, M
    OrganBLOOD
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsISOLATED FROM PERIPHERAL BLOOD CELLS
 
Molecule 2 - FAB 447-52D, HEAVY CHAIN
    ChainsH, I
    OrganBLOOD
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsISOLATED FROM PERIPHERAL BLOOD CELLS
 
Molecule 3 - GP120 V3 PEPTIDE
    ChainsP, Q
    EngineeredYES
    Other DetailsTHIS SEQUENCE OCCURS IN HIV-1 GP120
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit HILMPQ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Q1J)

(-) Sites  (0, 0)

(no "Site" information available for 1Q1J)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1H:22 -H:92
2H:142 -H:208
3I:22 -I:92
4I:142 -I:208
5L:23 -L:88
6L:134 -L:194
7M:23 -M:88
8M:134 -M:194

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Tyr L:140 -Pro L:141
2Phe H:148 -Pro H:149
3Glu H:150 -Pro H:151
4Tyr M:140 -Pro M:141
5Phe I:148 -Pro I:149
6Glu I:150 -Pro I:151

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Q1J)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Q1J)

(-) Exons   (0, 0)

(no "Exon" information available for 1Q1J)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain H from PDB  Type:PROTEIN  Length:231
                                                                                                                                                                                                                                                                        
               SCOP domains d1q1jh1 H:1-113 Immunoglobulin heavy chain variable domain, VH                                                                     d1q1jh2 H:114-227 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                      SCOP domains
               CATH domains 1q1jH01 H:1-113 Immunoglobulins                                                                                                    1q1jH02 H:114-223 Immunoglobulins                                                                 -- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee..hhhhheeeeeee......eeeeee.hhhhh..eee.......eeeeeehhh.eeeeee...hhhhheeeeeeeeeeeeee....eeeeeeeeee...eeeee........eeeee..........eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.hhh....eeeeeeehhh.eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1q1j H    1 EVQLVESGGGLVKPGGSLRLTCVASGFTFSDVWLNWVRQAPGKGLEWVGRIKSRTDGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYSCTTDGFIMIRGVSEDYYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL  227
                                    10        20        30        40        50  |||   57        67        77     |||84        94      100D|||||||102       112       122       134       144       154|||    169|      180|      191       203|      214       226 
                                                                              52A||                            82A||               100A|||||100J||                           130|                  154|||    169|      180|               200||               223| 
                                                                               52B|                             82B|                100B|||||100K|                            133                   156||     171       182                203|                226 
                                                                                52C                              82C                 100C|||||100L                                                   157|                                   205                    
                                                                                                                                      100D|||||                                                       162                                                          
                                                                                                                                       100E||||                                                                                                                    
                                                                                                                                        100F|||                                                                                                                    
                                                                                                                                         100G||                                                                                                                    
                                                                                                                                          100H|                                                                                                                    
                                                                                                                                           100I                                                                                                                    

Chain I from PDB  Type:PROTEIN  Length:231
                                                                                                                                                                                                                                                                        
               SCOP domains d1q1ji1 I:1-113 Immunoglobulin heavy chain variable domain, VH                                                                     d1q1ji2 I:114-227 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                      SCOP domains
               CATH domains 1q1jI01 I:1-113 Immunoglobulins                                                                                                    1q1jI02 I:114-223 Immunoglobulins                                                                 -- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhheeeeeee......eeeeee.hhhhh..eee.......eeeeeehhh.eeeeee...hhhhheeeeeeeeeeeeee....eeeeeeeeee...eeeee........eeeee..........eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.hhh....eeeeeeehhh.eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1q1j I    1 EVQLVESGGGLVKPGGSLRLTCVASGFTFSDVWLNWVRQAPGKGLEWVGRIKSRTDGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYSCTTDGFIMIRGVSEDYYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL  227
                                    10        20        30        40        50  |||   57        67        77     |||84        94      100D|||||||102       112       122       134       144       154|||    169|      180|      191       203|      214       226 
                                                                              52A||                            82A||               100A|||||100J||                           130|                  154|||    169|      180|               200||               223| 
                                                                               52B|                             82B|                100B|||||100K|                            133                   156||     171       182                203|                226 
                                                                                52C                              82C                 100C|||||100L                                                   157|                                   205                    
                                                                                                                                      100D|||||                                                       162                                                          
                                                                                                                                       100E||||                                                                                                                    
                                                                                                                                        100F|||                                                                                                                    
                                                                                                                                         100G||                                                                                                                    
                                                                                                                                          100H|                                                                                                                    
                                                                                                                                           100I                                                                                                                    

Chain L from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                        
               SCOP domains d1q1jl1 L:1-108 Immunoglobulin light chain lambda variable domain, VL-lambda                                     d1q1jl2 L:109-213 Immunoglobulin light chain lambda constant domain, CL-lambda                         SCOP domains
               CATH domains -1q1jL01 L:2-107 Immunoglobulins                                                                                1q1jL02 L:108-211 Immunoglobulins                                                                    -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee.....eeeeee...........eeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee.......eee...eeeee........eeeee..hhhhhh...eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1q1j L    1 QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIYGNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE  213
                                    11        21      ||29        39        49        59        69        79        89      ||96       106|      115       125       135       145       155       165  ||   176       186       196   ||  208     
                                    9|              27A|                                                                  95A||        106A                                                           168|                           200|          
                                    11               27B                                                                   95B|                                                                        170                            203          
                                                                                                                            95C                                                                                                                    

Chain M from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                        
               SCOP domains d1q1jm1 M:1-108 Immunoglobulin light chain lambda variable domain, VL-lambda                                     d1q1jm2 M:109-213 Immunoglobulin light chain lambda constant domain, CL-lambda                         SCOP domains
               CATH domains -1q1jM01 M:2-107 Immunoglobulins                                                                                1q1jM02 M:108-211 Immunoglobulins                                                                    -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee.....eeeeee...........eeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee.......eee...eeeee........eeeee..hhhhhh...eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1q1j M    1 QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIYGNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE  213
                                    11        21      ||29        39        49        59        69        79        89      ||96       106|      115       125       135       145       155       165  ||   176       186       196   ||  208     
                                    9|              27A|                                                                  95A||        106A                                                           168|                           200|          
                                    11               27B                                                                   95B|                                                                        170                            203          
                                                                                                                            95C                                                                                                                    

Chain P from PDB  Type:PROTEIN  Length:10
 aligned with ENV_HV1MN | P05877 from UniProtKB/Swiss-Prot  Length:856

    Alignment length:10
                                   319
           ENV_HV1MN    310 KRIHIGPGRA  319
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author ..eee..... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                1q1j P  305 KRIHIGPGRA  316
                                || 316
                              309|    
                               312    

Chain Q from PDB  Type:PROTEIN  Length:10
 aligned with ENV_HV1MN | P05877 from UniProtKB/Swiss-Prot  Length:856

    Alignment length:10
                                   319
           ENV_HV1MN    310 KRIHIGPGRA  319
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .eeee..... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                1q1j Q  305 KRIHIGPGRA  316
                                || 316
                              309|    
                               312    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 8)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 8)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)
1a1q1jH02H:114-223
1b1q1jI02I:114-223
1c1q1jL01L:2-107
1d1q1jM01M:2-107
1e1q1jL02L:108-211
1f1q1jM02M:108-211
1g1q1jH01H:1-113
1h1q1jI01I:1-113

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1Q1J)

(-) Gene Ontology  (22, 22)

Asymmetric/Biological Unit(hide GO term definitions)
Chain P,Q   (ENV_HV1MN | P05877)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0075512    clathrin-dependent endocytosis of virus by host cell    Any clathrin-mediated endocytosis that is involved in the uptake of a virus into a host cell. Begins by invagination of a specific region of the host cell plasma membrane around the bound virus to form a clathrin-coated pit, which then pinches off to form a clathrin-coated endocytic vesicle containing the virus.
    GO:0075509    endocytosis involved in viral entry into host cell    Any endocytosis that is involved in the uptake of a virus into a host cell.
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0039654    fusion of virus membrane with host endosome membrane    Fusion of a virus membrane with a host endosome membrane. Occurs after internalization of the virus through the endosomal pathway, and results in release of the virus contents into the cell.
    GO:0019064    fusion of virus membrane with host plasma membrane    Fusion of a viral membrane with the host cell membrane during viral entry. Results in release of the virion contents into the cytoplasm.
    GO:0039663    membrane fusion involved in viral entry into host cell    Merging of the virion membrane and a host membrane (host plasma membrane or host organelle membrane) that is involved in the uptake of a virus into a host cell.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019082    viral protein processing    Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a viral protein.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0044174    host cell endosome    A membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to host cell lysosomes for degradation.
    GO:0044175    host cell endosome membrane    The lipid bilayer surrounding a host cell endosome.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019031    viral envelope    The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1q1j)
 
  Sites
(no "Sites" information available for 1q1j)
 
  Cis Peptide Bonds
    Glu H:150 - Pro H:151   [ RasMol ]  
    Glu I:150 - Pro I:151   [ RasMol ]  
    Phe H:148 - Pro H:149   [ RasMol ]  
    Phe I:148 - Pro I:149   [ RasMol ]  
    Tyr L:140 - Pro L:141   [ RasMol ]  
    Tyr M:140 - Pro M:141   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1q1j
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENV_HV1MN | P05877
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ENV_HV1MN | P05877
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ENV_HV1MN | P058771acy 1ai1 1f58 1ggi 1k5m 1nak 1niz 1nj0 2b0s 2qsc 3e6h 3go1 3mlw 3mlx 3uji 4m1d 4xaw 4xbe 4xc1 4xc3 4xcf 4xmk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Q1J)