Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HYPOTHETICAL PROTEIN APC36103 FROM BACILLUS STEAROTHERMOPHILUS: A LIPID BINDING PROTEIN
 
Authors :  R. Zhang, J. Osipiuk, M. Zhou, R. Alkire, S. Moy, F. Collart, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  14 Jul 03  (Deposition) - 20 Jan 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Two Domains Containing Mixed Alpha/Beta Structures, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, J. Osipiuk, M. Zhou, R. Alkire, S. Moy, F. Collart, A. Joachimiak
Lipid Binding Protein Apc36103 From Bacillus Stearothermophilus
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN APC36103
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PDM68
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RBSTP0788
    Organism Scientific: GEOBACILLUS STEAROTHERMOPHILUS
    Organism Taxid: 1422

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PLM2Ligand/IonPALMITIC ACID
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1PLM1Ligand/IonPALMITIC ACID
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PLM1Ligand/IonPALMITIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR B:60 , ALA B:61 , GLN B:62 , SER B:92 , SER B:123 , LEU B:169 , ARG B:174 , LEU B:199 , SER B:234 , ILE B:263 , HIS B:270 , ALA B:277 , HOH B:498BINDING SITE FOR RESIDUE PLM B 701
2AC2SOFTWARETHR A:60 , ALA A:61 , GLN A:62 , PHE A:87 , SER A:92 , SER A:123 , ARG A:174 , LEU A:199 , SER A:234 , ILE A:263 , HIS A:270 , ALA A:277 , HOH A:341BINDING SITE FOR RESIDUE PLM A 702

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PZX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PZX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PZX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PZX)

(-) Exons   (0, 0)

(no "Exon" information available for 1PZX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:277
 aligned with P83812_GEOSE | P83812 from UniProtKB/TrEMBL  Length:287

    Alignment length:287
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       
         P83812_GEOSE     1 MPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISKTAAAFGGLLNIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI 287
               SCOP domains d1pzxa_ A: Hypothetical protein apc36103                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1pzxA01 A:1-27,A:63-155    1pzxA02 A:28-62 degv family protein1pzxA01 A:1-27,A:63-155 Dihydroxyacetone kinase; domain 1                                    1pzxA03 A:156-287  [c          ode=3.30.1180.10, no name defined]                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.hhh.hhhhhhhh..eee..eeee..eeee.....hhhhhhhhhh.....eee..hhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhheeeeee...hhhhhhhh...----------.eeeeeeee..eeeeeeeeehhhhhhhhhhhhhhhhh.hhhh.eeeeee..hhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhh...eeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pzx A   1 MPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRIS----------NIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI 287
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     |   -      |190       200       210       220       230       240       250       260       270       280       
                                                                                                                                                                                                         176        187                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:289
 aligned with P83812_GEOSE | P83812 from UniProtKB/TrEMBL  Length:287

    Alignment length:289
                              1                                                                                                                                                                                                                                                                                              
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278         
         P83812_GEOSE     - --MPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISKTAAAFGGLLNIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI 287
               SCOP domains d1pzxb_ B: Hypothetical protein apc36103                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1pzxB01 B:-1-27,B:63-155     1pzxB02 B:28-62 degv family protein1pzxB01 B:-1-27,B:63-155 Dihydroxyacetone kinase; domain 1                                   1pzxB03 B:156-287  [code=3.30.1180.10, no name defined]                                                                              CATH domains
           Pfam domains (1) -----------------------------------------------------------------------DegV-1pzxB01 B:70-283                                                                                                                                                                                                 ---- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------DegV-1pzxB02 B:70-283                                                                                                                                                                                                 ---- Pfam domains (2)
         Sec.struct. author .....eeeee.hhh.hhhhhhhh..eee..eeee..eeee.....hhhhhhhhhhh....eee..hhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.eeeeee...hhhhhhhh........hhhhhh.eeeeeee..eeeeeeee.hhhhhhhhhhhhhhhhh.hhhhh.eeeee..hhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhh...eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pzx B  -1 NAMPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISKTAAAFGGLLNIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI 287
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: EDD (22)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (P83812_GEOSE | P83812)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PLM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pzx)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pzx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P83812_GEOSE | P83812
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P83812_GEOSE | P83812
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PZX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PZX)