|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1PUX) |
Sites (0, 0)| (no "Site" information available for 1PUX) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1PUX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PUX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PUX) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1PUX) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:124 aligned with SP0F_BACSU | P06628 from UniProtKB/Swiss-Prot Length:124 Alignment length:124 10 20 30 40 50 60 70 80 90 100 110 120 SP0F_BACSU 1 MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 124 SCOP domains d1puxa_ A: Sporulation response regulator Spo0F SCOP domains CATH domains 1puxA00 A:1-124 [code=3.40.50.2300, no name defined] CATH domains Pfam domains -----Response_reg-1puxA01 A:6-116 -------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----RESPONSE_REGULATORY PDB: A:5-119 UniProt: 5-119 ----- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 1pux A 1 MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 124 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (SP0F_BACSU | P06628)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|