|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1POS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1POS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1POS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1POS) |
PROSITE Motifs (2, 8)
Asymmetric Unit (2, 8)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1POS) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:106 aligned with TFF2_PIG | P01359 from UniProtKB/Swiss-Prot Length:127 Alignment length:106 31 41 51 61 71 81 91 101 111 121 TFF2_PIG 22 QKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMEVSARKNCGYPGISPEDCARRNCCFSDTIPEVPWCFFPMSVEDCHY 127 SCOP domains d1posa1 A:1-53 Pancreatic spasmolytic polypeptide d1posa2 A:54-106 Pancreatic spasmolytic polypeptide SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----P_TREFOIL_2 PDB: A:6-50 UniProt: 27-71 -----P_TREFOIL_2 PDB: A:56-99 UniProt: 77-120 ------- PROSITE (1) PROSITE (2) ---------------P_TREFOIL_1 ----------------------------P_TREFOIL_1 --------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1pos A 1 xKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMQVSARKNCGYPGISPEDCAARNCCFSDTIPEVPWCFFPMSVEDCHY 106 | 10 20 30 40 50 60 70 80 90 100 | 1-PCA Chain B from PDB Type:PROTEIN Length:106 aligned with TFF2_PIG | P01359 from UniProtKB/Swiss-Prot Length:127 Alignment length:106 31 41 51 61 71 81 91 101 111 121 TFF2_PIG 22 QKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMEVSARKNCGYPGISPEDCARRNCCFSDTIPEVPWCFFPMSVEDCHY 127 SCOP domains d1posb1 B:1-53 Pancreatic spasmolytic polypeptide d1posb2 B:54-106 Pancreatic spasmolytic polypeptide SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----P_TREFOIL_2 PDB: B:6-50 UniProt: 27-71 -----P_TREFOIL_2 PDB: B:56-99 UniProt: 77-120 ------- PROSITE (1) PROSITE (2) ---------------P_TREFOIL_1 ----------------------------P_TREFOIL_1 --------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1pos B 1 xKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMQVSARKNCGYPGISPEDCAARNCCFSDTIPEVPWCFFPMSVEDCHY 106 | 10 20 30 40 50 60 70 80 90 100 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 4)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1POS) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1POS) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B (TFF2_PIG | P01359)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|