Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A TREFOIL-MOTIF-CONTAINING CELL GROWTH FACTOR, PORCINE SPASMOLYTIC PROTEIN
 
Authors :  M. D. Carr, C. J. Bauer, M. J. Gradwell, J. Feeney
Date :  04 Feb 93  (Deposition) - 31 May 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
Keywords :  Growth Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Carr, C. J. Bauer, M. J. Gradwell, J. Feeney
Solution Structure Of A Trefoil-Motif-Containing Cell Growth Factor, Porcine Spasmolytic Protein.
Proc. Natl. Acad. Sci. Usa V. 91 2206 1994
PubMed-ID: 8134374  |  Reference-DOI: 10.1073/PNAS.91.6.2206
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PORCINE SPASMOLYTIC PROTEIN
    Chains: A
    Engineered: YES
    Organism Common: PIG
    Organism Scientific: SUS SCROFA
    Organism Taxid: 9823

 Structural Features

(-) Chains, Units

  
NMR Structure (19x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PCP)

(-) Sites  (0, 0)

(no "Site" information available for 1PCP)

(-) SS Bonds  (7, 7)

NMR Structure
No.Residues
1A:6 -A:104
2A:8 -A:35
3A:19 -A:34
4A:29 -A:46
5A:58 -A:84
6A:68 -A:83
7A:78 -A:95

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PCP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PCP)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1P_TREFOIL_2PS51448 P-type 'Trefoil' domain profile.TFF2_PIG27-71
77-120		  2A:6-50
A:56-99
2P_TREFOIL_1PS00025 P-type 'Trefoil' domain signature.TFF2_PIG37-57
86-106		  2A:16-36
A:65-85

(-) Exons   (0, 0)

(no "Exon" information available for 1PCP)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:106
 aligned with TFF2_PIG | P01359 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:106
                                    31        41        51        61        71        81        91       101       111       121      
             TFF2_PIG    22 QKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMEVSARKNCGYPGISPEDCARRNCCFSDTIPEVPWCFFPMSVEDCHY 127
               SCOP domains d1pcpa1 A:1-53 Pancreatic spasmolytic polypeptide    d1pcpa2 A:54-106 Pancreatic spasmolytic polypeptide   SCOP domains
               CATH domains 1pcpA01 A:1-59,A:100-106 Spasmolytic Protein, domain 1     1pcpA02 A:60-99                         1pcpA01 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.................hhhhhh.eeeee......eeeee..........................hhhhhh.eeeee......eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----P_TREFOIL_2  PDB: A:6-50 UniProt: 27-71      -----P_TREFOIL_2  PDB: A:56-99 UniProt: 77-120   ------- PROSITE (1)
                PROSITE (2) ---------------P_TREFOIL_1          ----------------------------P_TREFOIL_1          --------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1pcp A   1 EKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQESEECVMQVSARKNCGYPGISPEDCAARNCCFSDTIPEVPWCFFPMSVEDCHY 106
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Few Secondary Structures (1120)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1PCP)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (TFF2_PIG | P01359)
molecular function
    GO:0008083    growth factor activity    The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pcp)
 
  Sites
(no "Sites" information available for 1pcp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pcp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pcp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TFF2_PIG | P01359
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TFF2_PIG | P01359
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TFF2_PIG | P01359: 1pos 1psp 2psp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PCP)