|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1P90) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1P90) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1P90) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1P90) |
Exons (0, 0)| (no "Exon" information available for 1P90) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:123 aligned with Q9F5X9_AZOVI | Q9F5X9 from UniProtKB/TrEMBL Length:243 Alignment length:123 108 118 128 138 148 158 168 178 188 198 208 218 Q9F5X9_AZOVI 99 ERVPEGSIRVAIASNNGEQLDGHFGSCLRFLVYQVSAKDASLVDIRSTLDVALAEDKNAWRVEQIQDCQVLYVVSIGGPAAAKVVRAGIHPLKKPKGCAAQEAIAELQTVMAGSPPPWLAKLV 221 SCOP domains d1p90a_ A: NafY core domain SCOP domains CATH domains 1p90A00 A:99-221 [code=3.30.420.130, no name defined] CATH domains Pfam domains ---------------Nitro_FeMo-Co-1p90A01 A:114-207 -------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript 1p90 A 99 ERVPEGSIRVAIASNNGEQLDGHFGSCLRFLVYQVSAKDASLVDIRSTLDVALAEDKNAWRVEQIQDCQVLYVVSIGGPAAAKVVRAGIHPLKKPKGCAAQEAIAELQTVMAGSPPPWLAKLV 221 108 118 128 138 148 158 168 178 188 198 208 218
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9F5X9_AZOVI | Q9F5X9)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|