Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE DNA BINDING DOMAIN OF THE REPRESSOR BLAI.
 
Authors :  H. V. Melckebeke, C. Vreuls, P. Gans, G. Llabres, P. Filee, B. Joris, J. P. Simorre
Date :  30 Apr 03  (Deposition) - 09 Dec 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
Keywords :  Transcription Regulation, Repressor, Dna-Binding, Winged Helix Protein, Bacterial Resistance To Antibiotics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. V. Melckebeke, C. Vreuls, P. Gans, G. Llabres, B. Joris, J. P. Simorre
Solution Structural Study Of Blai: Implications For The Repression Of Genes Involved In Beta-Lactam Antibiotic Resistance.
J. Mol. Biol. V. 333 711 2003
PubMed-ID: 14568532  |  Reference-DOI: 10.1016/J.JMB.2003.09.005
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PENICILLINASE REPRESSOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET22
    Expression System Strain: BL21(DE3) PLYS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: N-TERMINAL DOMAIN (RESIDUES 1-82)
    Gene: BLAI OR PENI
    Organism Scientific: BACILLUS LICHENIFORMIS
    Organism Taxid: 1402
    Synonym: REGULATORY PROTEIN BLAI, BETA-LACTAMASE REPRESSOR PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (19x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1P6R)

(-) Sites  (0, 0)

(no "Site" information available for 1P6R)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1P6R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1P6R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1P6R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1P6R)

(-) Exons   (0, 0)

(no "Exon" information available for 1P6R)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:82
 aligned with BLAI_BACLI | P06555 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:82
                                    10        20        30        40        50        60        70        80  
            BLAI_BACLI    1 MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS 82
               SCOP domains d1p6ra_ A: Penicillinase repressor BlaI                                            SCOP domains
               CATH domains 1p6rA00 A:1-82 'winged helix' repressor DNA binding domain                         CATH domains
               Pfam domains ------Pencillinase_R-1p6rA01 A:7-82                                                Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhh...eehhhhhhhhhhhh..hhhhhhhhhhhhhhh..eeeeee..eeeeee............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                  1p6r A  1 MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS 82
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: HTH (544)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (BLAI_BACLI | P06555)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1p6r)
 
  Sites
(no "Sites" information available for 1p6r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1p6r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1p6r
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BLAI_BACLI | P06555
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BLAI_BACLI | P06555
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BLAI_BACLI | P06555: 2p7c

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1P6R)