|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1P4I) |
(no "Site" information available for 1P4I) |
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 1P4I) |
(no "SAP(SNP)/Variant" information available for 1P4I) |
(no "PROSITE Motif" information available for 1P4I) |
(no "Exon" information available for 1P4I) |
Asymmetric/Biological UnitChain H from PDB Type:PROTEIN Length:112 aligned with HVM44_MOUSE | P01820 from UniProtKB/Swiss-Prot Length:115 Alignment length:112 115 29 39 49 59 69 79 89 99 109 | - - HVM44_MOUSE 20 QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCA---------------- - SCOP domains d1p4ih_ H: Immunoglobulin heavy chain variable domain, VH SCOP domains CATH domains 1p4iH00 H:1-148 Immunoglobulins CATH domains Pfam domains -V-set-1p4iH01 H:2-106 ----------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1p4i H 1 DVQLQESGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS 148 ||11 21 || 32|| 47 57 || 71 81 91 101 136 146 7| 27| 33| 60| 110| 9 29 39 65 136 Chain L from PDB Type:PROTEIN Length:110 aligned with LV1A_MOUSE | P01723 from UniProtKB/Swiss-Prot Length:117 Alignment length:110 117 29 39 49 59 69 79 89 99 109 | - - LV1A_MOUSE 20 SQAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNH------------ - SCOP domains d1p4il_ L: Immunoglobulin light chain lambda variable domain, VL-lambda SCOP domains CATH domains 1p4iL00 L:0-148 Immunoglobulins CATH domains Pfam domains --V-set-1p4iL01 L:2-136 ------------ Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1p4i L 0 ADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL 148 |10 20 ||31 || 45 55 || 73 83|| 95 105 ||138 148 7| 27| 33| 58| 84| 111| 9 29 38 67 87 135
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain H (HVM44_MOUSE | P01820)
Chain L (LV1A_MOUSE | P01723)
|
|
|
|
|
|
|