|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1P1L) |
Sites (0, 0)| (no "Site" information available for 1P1L) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1P1L) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1P1L) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1P1L) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1P1L) |
Exons (0, 0)| (no "Exon" information available for 1P1L) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:102 aligned with CUTA_ARCFU | O28301 from UniProtKB/Swiss-Prot Length:102 Alignment length:102 10 20 30 40 50 60 70 80 90 100 CUTA_ARCFU 1 MHNFIYITAPSLEEAERIAKRLLEKKLAACVNIFPIKSFFWWEGKIEAATEFAMIVKTRSEKFAEVRDEVKAMHSYTTPCICAIPIERGLKEFLDWIDETVE 102 SCOP domains d1p1la_ A: Cut A1 SCOP domains CATH domains 1p1lA00 A:1-102 [code=3.30.70.830, no name defined] CATH domains Pfam domains -CutA1-1p1lA01 A:2-102 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 1p1l A 1 MHNFIYITAPSLEEAERIAKRLLEKKLAACVNIFPIKSFFWWEGKIEAATEFAMIVKTRSEKFAEVRDEVKAMHSYTTPCICAIPIERGLKEFLDWIDETVE 102 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (CUTA_ARCFU | O28301)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|