Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  GLOBAL STRUCTURE AND DYNAMICS OF HUMAN APOLIPOPROTEIN CII IN COMPLEX WITH MICELLES: EVIDENCE FOR INCREASED MOBILITY OF THE HELIX INVOLVVED IN THE ACTIVATION OF LIPOPROTEIN LIPASE.
 
Authors :  J. Zdunek, G. V. Martinez, J. Schleucher, P. O. Lycksell, Y. Yin, S. Nilsson, Y. Shen, G. Olivecrona, S. Wijmenga
Date :  29 Nov 02  (Deposition) - 18 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (68x)
Keywords :  Apocii, Lpl, Activation Mechanism, Domain Motion, Sds, Micelle, Global Structure, Local Structure, Structure, Dynamics, Helix , Lipid Transport, Lipid Degradation, Chylomicron (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Zdunek, G. V. Martinez, J. Schleucher, P. O. Lycksell, Y. Yin, S. Nilsson, Y. Shen, G. Olivecrona, S. Wijmenga
Global Structure And Dynamics Of Human Apolipoprotein Cii In Complex With Micelles: Evidence For Increased Mobility Of The Helix Involved In The Activation Of Lipoprotein Lipase
Biochemistry V. 42 1872 2003
PubMed-ID: 12590574  |  Reference-DOI: 10.1021/BI0267184

(-) Compounds

Molecule 1 - APOLIPOPROTEIN C-II
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET29A-HAPOCII
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET29A(+)
    OrganLIVER
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPO-CII

 Structural Features

(-) Chains, Units

  
NMR Structure (68x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1O8T)

(-) Sites  (0, 0)

(no "Site" information available for 1O8T)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1O8T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1O8T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

NMR Structure (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_000639K41TAPOC2_HUMANPolymorphism120074114AK19T
2UniProtVAR_000640W48RAPOC2_HUMANDisease (HLPP1B)120074115AW26R
3UniProtVAR_000641E60KAPOC2_HUMANPolymorphism5122AE38K
4UniProtVAR_000642K77QAPOC2_HUMANPolymorphism5126AK55Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1O8T)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002524901ENSE00001735377chr19:45449243-4544933290APOC2_HUMAN-00--
1.2ENST000002524902ENSE00001619840chr19:45451723-4545179068APOC2_HUMAN1-19190--
1.3ENST000002524903ENSE00001774016chr19:45451958-45452117160APOC2_HUMAN19-72541A:1-5050
1.4ENST000002524904ENSE00001643075chr19:45452416-45452814399APOC2_HUMAN72-101301A:50-7930

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:79
 aligned with APOC2_HUMAN | P02655 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:79
                                    32        42        52        62        72        82        92         
          APOC2_HUMAN    23 TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE 101
               SCOP domains d1o8ta_ A: Fragments of apolipoproteins                                         SCOP domains
               CATH domains 1o8tA00 A:1-79  [code=1.10.1440.10, no name defined]                            CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.....hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------T------R-----------K----------------Q------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-50 UniProt: 19-72 [INCOMPLETE] ----------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.4  PDB: A:50-79         Transcript 1 (2)
                 1o8t A   1 TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE  79
                                    10        20        30        40        50        60        70         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1O8T)

(-) Gene Ontology  (44, 44)

NMR Structure(hide GO term definitions)
Chain A   (APOC2_HUMAN | P02655)
molecular function
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0055102    lipase inhibitor activity    Stops, prevents or reduces the activity of a lipase, an enzyme that catalyzes of the hydrolysis of a lipid.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0060230    lipoprotein lipase activator activity    Binds to and increases the activity of a lipoprotein lipase, an enzyme that catalyzes of the hydrolysis of a lipid within a lipoprotein.
    GO:0016004    phospholipase activator activity    Increases the activity of a phospholipase, an enzyme that catalyzes of the hydrolysis of a glycerophospholipid.
    GO:0043274    phospholipase binding    Interacting selectively and non-covalently with any phospholipase, enzymes that catalyze of the hydrolysis of a glycerophospholipid.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0033344    cholesterol efflux    The directed movement of cholesterol, cholest-5-en-3-beta-ol, out of a cell or organelle.
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0034382    chylomicron remnant clearance    The process in which a chylomicron remnant is removed from the blood via receptor-mediated endocytosis into liver cells and its constituent parts degraded.
    GO:0034371    chylomicron remodeling    The acquisition, loss or modification of a protein or lipid within a chylomicron, including the hydrolysis of triglyceride by lipoprotein lipase and the subsequent loss of free fatty acid.
    GO:0034384    high-density lipoprotein particle clearance    The process in which a high-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0006869    lipid transport    The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0032375    negative regulation of cholesterol transport    Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of cholesterol into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0045833    negative regulation of lipid metabolic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving lipids.
    GO:0048261    negative regulation of receptor-mediated endocytosis    Any process that stops, prevents, or reduces the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
    GO:0010916    negative regulation of very-low-density lipoprotein particle clearance    Any process that decreases the rate, frequency or extent of very-low-density lipoprotein particle clearance. Very-low-density lipoprotein particle clearance is the process in which a very-low-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:0033700    phospholipid efflux    The directed movement of a phospholipid out of a cell or organelle.
    GO:0045723    positive regulation of fatty acid biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of fatty acids.
    GO:0051006    positive regulation of lipoprotein lipase activity    Any process that activates or increases the activity of the enzyme lipoprotein lipase.
    GO:0010518    positive regulation of phospholipase activity    Any process that increases the frequency, rate or extent of phospholipase activity, the hydrolysis of a phospholipid.
    GO:0060697    positive regulation of phospholipid catabolic process    Any process that increases the rate, frequency, or extent of phospholipid catabolism, the chemical reactions and pathways resulting in the breakdown of phospholipids, any lipid containing phosphoric acid as a mono- or diester.
    GO:0010898    positive regulation of triglyceride catabolic process    Any process that increases the frequency, rate, or extent of the chemical reactions and pathways resulting in the breakdown of triglyceride.
    GO:0010902    positive regulation of very-low-density lipoprotein particle remodeling    Any process that increases the rate, frequency or extent of very-low-density lipoprotein particle remodeling. Very-low-density lipoprotein particle remodeling is the acquisition, loss or modification of a protein or lipid within a very-low-density lipoprotein particle, including the hydrolysis of triglyceride by hepatic lipase or lipoprotein lipase and the subsequent loss of free fatty acid.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0043691    reverse cholesterol transport    The directed movement of peripheral cell cholesterol, cholest-5-en-3-beta-ol, towards the liver for catabolism.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0070328    triglyceride homeostasis    Any process involved in the maintenance of an internal steady state of triglyceride within an organism or cell.
    GO:0034370    triglyceride-rich lipoprotein particle remodeling    The acquisition, loss or modification of a protein or lipid within a triglyceride-rich lipoprotein particle, including the hydrolysis of triglyceride by lipoprotein lipase, with the subsequent loss of free fatty acid, and the transfer of cholesterol esters to a triglyceride-rich lipoprotein particle by cholesteryl ester transfer protein (CETP), with the simultaneous transfer of triglyceride from a triglyceride-rich lipoprotein particle.
    GO:0034372    very-low-density lipoprotein particle remodeling    The acquisition, loss or modification of a protein or lipid within a very-low-density lipoprotein particle, including the hydrolysis of triglyceride by hepatic lipase or lipoprotein lipase and the subsequent loss of free fatty acid.
cellular component
    GO:0042627    chylomicron    A large lipoprotein particle (diameter 75-1200 nm) composed of a central core of triglycerides and cholesterol surrounded by a protein-phospholipid coating. The proteins include one molecule of apolipoprotein B-48 and may include a variety of apolipoproteins, including APOAs, APOCs and APOE. Chylomicrons are found in blood or lymph and carry lipids from the intestines into other body tissues.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0034364    high-density lipoprotein particle    A lipoprotein particle with a high density (typically 1.063-1.21 g/ml) and a diameter of 5-10 nm that contains APOAs and may contain APOCs and APOE; found in blood and carries lipids from body tissues to the liver as part of the reverse cholesterol transport process.
    GO:0034363    intermediate-density lipoprotein particle    A triglyceride-rich lipoprotein particle that typically contains APOB100, APOE and APOCs and has a density of 1.006-1.019 g/ml and a diameter of between 25-30 nm. IDL particles are found in blood and are formed by the delipidation of very-low-density lipoprotein particles (VLDL). IDL particles are removed from blood by the liver, following binding to the APOE receptor, or are converted to low-density lipoprotein (LDL).
    GO:0034362    low-density lipoprotein particle    A lipoprotein particle, rich in cholesterol esters and low in triglycerides that is typically composed of APOB100 and APOE and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm. LDL particles are formed from VLDL particles (via IDL) by the loss of triglyceride and gain of cholesterol ester. They transport endogenous cholesterol (and to some extent triglycerides) from peripheral tissues back to the liver.
    GO:0034366    spherical high-density lipoprotein particle    A mature high-density lipoprotein (HDL) particle, converted from discoidal HDL particles following the esterification of cholesterol in the particle by phosphatidylcholine-sterol O-acyltransferase (lecithin cholesterol acyltransferase; LCAT).
    GO:0034361    very-low-density lipoprotein particle    A triglyceride-rich lipoprotein particle that is typically composed of APOB100, APOE and APOCs and has a density of about 1.006 g/ml and a diameter of between 20-80 nm. It is found in blood and transports endogenous products (newly synthesized cholesterol and triglycerides) from the liver.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1o8t)
 
  Sites
(no "Sites" information available for 1o8t)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1o8t)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o8t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APOC2_HUMAN | P02655
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  207750
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  APOC2_HUMAN | P02655
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        APOC2_HUMAN | P026551by6 1i5j 1soh

(-) Related Entries Specified in the PDB File

1by6 PEPTIDE OF HUMAN APOLIPOPROTEIN C-II
1i5j NMR STRUCTURE OF HUMAN APOLIPOPROTEIN C-II IN THE PRESENCE OF SDS