|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1O5U) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1O5U) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1O5U) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1O5U) |
Exons (0, 0)| (no "Exon" information available for 1O5U) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with Q9X0J6_THEMA | Q9X0J6 from UniProtKB/TrEMBL Length:89 Alignment length:88 11 21 31 41 51 61 71 81 Q9X0J6_THEMA 2 EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 SCOP domains d1o5ua_ A: Hypothetical protein TM1112 SCOP domains CATH domains 1o5uA00 A:2-89 Jelly Rolls CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1o5u A 2 EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 11 21 31 41 51 61 71 81 Chain B from PDB Type:PROTEIN Length:88 aligned with Q9X0J6_THEMA | Q9X0J6 from UniProtKB/TrEMBL Length:89 Alignment length:88 11 21 31 41 51 61 71 81 Q9X0J6_THEMA 2 EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 SCOP domains d1o5ub_ B: Hypothetical protein TM1112 SCOP domains CATH domains 1o5uB00 B:2-89 Jelly Rolls CATH domains Pfam domains (1) -----------Cupin_3-1o5uB01 B:13-86 --- Pfam domains (1) Pfam domains (2) -----------Cupin_3-1o5uB02 B:13-86 --- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1o5u B 2 EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 11 21 31 41 51 61 71 81
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1O5U)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|