Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  A NEW PARADIGM FOR TUMOR NECROSIS FACTOR SIGNALLING
 
Authors :  J. H. Naismith, S. R. Sprang
Date :  12 Oct 94  (Deposition) - 07 Dec 95  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Binding Protein, Cytokine, Signalling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. H. Naismith, T. Q. Devine, B. J. Brandhuber, S. R. Sprang
Crystallographic Evidence For Dimerization Of Unliganded Tumor Necrosis Factor Receptor.
J. Biol. Chem. V. 270 13303 1995
PubMed-ID: 7768931  |  Reference-DOI: 10.1074/JBC.270.22.13303
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TUMOR NECROSIS FACTOR RECEPTOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsTHE CONSTRUCT CONTAINS RESIDUES 12 - 172 OF THE MATURE RECEPTOR SEQUENCE
    Other Details - SourceRESIDUE 11 IS MUTATED TO MET AS A RESULT OF THE EXPRESSION SYSTEM
    SynonymTYPE I RECEPTOR, STNFR1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NCF)

(-) Sites  (0, 0)

(no "Site" information available for 1NCF)

(-) SS Bonds  (20, 20)

Asymmetric/Biological Unit
No.Residues
1A:15 -A:29
2A:30 -A:43
3A:33 -A:52
4A:55 -A:70
5A:73 -A:88
6A:76 -A:96
7A:98 -A:114
8A:117 -A:129
9A:120 -A:137
10A:139 -A:150
11B:15 -B:29
12B:30 -B:43
13B:33 -B:52
14B:55 -B:70
15B:73 -B:88
16B:76 -B:96
17B:98 -B:114
18B:117 -B:129
19B:120 -B:137
20B:139 -B:150

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NCF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (14, 28)

Asymmetric/Biological Unit (14, 28)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_019329H51QTNR1A_HUMANDisease (FHF)104895254A/BH22Q
02UniProtVAR_013410C59RTNR1A_HUMANDisease (FHF)104895217A/BC30R
03UniProtVAR_019302C59STNR1A_HUMANDisease (FHF)104895223A/BC30S
04UniProtVAR_019303C62GTNR1A_HUMANDisease (FHF)104895225A/BC33G
05UniProtVAR_013411C62YTNR1A_HUMANDisease (FHF)104895218A/BC33Y
06UniProtVAR_019330P75LTNR1A_HUMANDisease (FHF)4149637A/BP46L
07UniProtVAR_013412T79MTNR1A_HUMANDisease (FHF)104895219A/BT50M
08UniProtVAR_013413C81FTNR1A_HUMANDisease (FHF)104895220A/BC52F
09UniProtVAR_019304C99STNR1A_HUMANDisease (FHF)104895228A/BC70S
10UniProtVAR_019331S115GTNR1A_HUMANDisease (FHF)  ---A/BS86G
11UniProtVAR_013414C117RTNR1A_HUMANDisease (FHF)104895221A/BC88R
12UniProtVAR_013415C117YTNR1A_HUMANDisease (FHF)104895222A/BC88Y
13UniProtVAR_019305R121PTNR1A_HUMANDisease (FHF)4149584A/BR92P
14UniProtVAR_019332R121QTNR1A_HUMANUnclassified (FHF)4149584A/BR92Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 12)

Asymmetric/Biological Unit (2, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNFR_NGFR_2PS50050 TNFR/NGFR family cysteine-rich region domain profile.TNR1A_HUMAN43-81
 
83-125
 
126-166
 
  6A:14-52
B:14-52
A:54-96
B:54-96
A:97-137
B:97-137
2TNFR_NGFR_1PS00652 TNFR/NGFR family cysteine-rich region signature.TNR1A_HUMAN44-81
 
84-125
 
125-166
 
  6A:15-52
B:15-52
A:55-96
B:55-96
A:96-137
B:96-137

(-) Exons   (5, 9)

Asymmetric/Biological Unit (5, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000001627491ENSE00001044275chr12:6451261-6450942320TNR1A_HUMAN1-13130--
1.2ENST000001627492ENSE00000714951chr12:6443410-6443257154TNR1A_HUMAN14-65522A:11-36
B:14-36
26
23
1.3ENST000001627493ENSE00000714950chr12:6443031-6442903129TNR1A_HUMAN65-108442A:36-79
B:36-79
44
44
1.4ENST000001627494ENSE00000714949chr12:6442682-6442533150TNR1A_HUMAN108-158512A:79-129
B:79-129
51
51
1.5ENST000001627495ENSE00000714948chr12:6442313-644223579TNR1A_HUMAN158-184272A:129-150
B:129-155
22
27
1.7ENST000001627497ENSE00000714947chr12:6440092-644001974TNR1A_HUMAN184-209261-
B:155-155
-
1
1.8ENST000001627498ENSE00000714946chr12:6439877-6439764114TNR1A_HUMAN209-247390--
1.9ENST000001627499ENSE00000714944chr12:6439461-643943329TNR1A_HUMAN247-256100--
1.10ENST0000016274910ENSE00000714943chr12:6439232-6438944289TNR1A_HUMAN257-353970--
1.11ENST0000016274911ENSE00000866894chr12:6438788-6437924865TNR1A_HUMAN353-4551030--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:140
 aligned with TNR1A_HUMAN | P19438 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:140
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179
          TNR1A_HUMAN    40 RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENEC 179
               SCOP domains d1ncfa1 A:11-71 Tumor necrosis factor (TNF) receptor         d1ncfa2 A:72-115                            d1ncfa3 A:116-150                   SCOP domains
               CATH domains 1ncfA01 A:11-97 Tumor Necrosis Factor Receptor, subunit A, domain 2                    1ncfA02 A:98-150                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..eeeeeee.....eeeee.........eeee....ee..........ee....hhhhh.eeee........eee....eeeee.....eeeee......eeeee........eeee........... Sec.struct. author
             SAPs(SNPs) (1) -----------Q-------R--G------------L---M-F-----------------S---------------G-R---P---------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------S--Y------------------------------------------------------Y---Q---------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) ---TNFR_NGFR_2  PDB: A:14-52              -TNFR_NGFR_2  PDB: A:54-96 UniProt: 83-125  TNFR_NGFR_2  PDB: A:97-137               ------------- PROSITE (1)
                PROSITE (2) ----TNFR_NGFR_1  PDB: A:15-52             --TNFR_NGFR_1  PDB: A:55-96 UniProt: 84-125 ------------------------------------------------------ PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------TNFR_NGFR_1  PDB: A:96-137                ------------- PROSITE (3)
           Transcript 1 (1) Exon 1.2  PDB: A:11-36    ------------------------------------------Exon 1.4  PDB: A:79-129 UniProt: 108-158           --------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.3  PDB: A:36-79 UniProt: 65-108      -------------------------------------------------Exon 1.5 [INCOMPLETE]  Transcript 1 (2)
                 1ncf A  11 MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENEC 150
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain B from PDB  Type:PROTEIN  Length:142
 aligned with TNR1A_HUMAN | P19438 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:142
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182  
          TNR1A_HUMAN    43 VCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSN 184
               SCOP domains d1ncfb1 B:14-71 Tumor necrosis factor (TNF) receptor      d1ncfb2 B:72-115                            d1ncfb3 B:116-155                        SCOP domains
               CATH domains 1ncfB01 B:14-97 Tumor Necrosis Factor Receptor, subunit A, domain 2                 1ncfB02 B:98-150                                     ----- CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------TNFR_c6-1ncfB01 B:98-137                ------------------ Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------TNFR_c6-1ncfB02 B:98-137                ------------------ Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------TNFR_c6-1ncfB03 B:98-137                ------------------ Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------TNFR_c6-1ncfB04 B:98-137                ------------------ Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------TNFR_c6-1ncfB05 B:98-137                ------------------ Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------TNFR_c6-1ncfB06 B:98-137                ------------------ Pfam domains (6)
         Sec.struct. author .....eee.......eee.....eeeee.........eeee....ee..........ee....hhhhh.eeee........eee....eeeee.....eeeee........eee........ee.....eeee..eeee... Sec.struct. author
             SAPs(SNPs) (1) --------Q-------R--G------------L---M-F-----------------S---------------G-R---P--------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------S--Y------------------------------------------------------Y---Q--------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) TNFR_NGFR_2  PDB: B:14-52              -TNFR_NGFR_2  PDB: B:54-96 UniProt: 83-125  TNFR_NGFR_2  PDB: B:97-137               ------------------ PROSITE (1)
                PROSITE (2) -TNFR_NGFR_1  PDB: B:15-52             --TNFR_NGFR_1  PDB: B:55-96 UniProt: 84-125 ----------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------TNFR_NGFR_1  PDB: B:96-137                ------------------ PROSITE (3)
           Transcript 1 (1) Exon 1.2  PDB: B:14-36 ------------------------------------------Exon 1.4  PDB: B:79-129 UniProt: 108-158           -------------------------1 Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.3  PDB: B:36-79 UniProt: 65-108      -------------------------------------------------Exon 1.5  PDB: B:129-155    Transcript 1 (2)
                 1ncf B  14 VCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSN 155
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 6)

Asymmetric/Biological Unit

(-) Gene Ontology  (42, 42)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (TNR1A_HUMAN | P19438)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043120    tumor necrosis factor binding    Interacting selectively and non-covalently with tumor necrosis factor, a proinflammatory cytokine produced by monocytes and macrophages.
    GO:0005031    tumor necrosis factor-activated receptor activity    Combining with tumor necrosis factor, a proinflammatory cytokine produced by monocytes and macrophages, to initiate a change in cell function.
biological process
    GO:0007249    I-kappaB kinase/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071260    cellular response to mechanical stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0071550    death-inducing signaling complex assembly    A process of protein complex assembly in which the arrangement and bonding together of the set of components that form the protein complex is mediated by a death domain (DD) interaction, as part of the extrinsic apoptotic signaling pathway.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0090002    establishment of protein localization to plasma membrane    The directed movement of a protein to a specific location in the plasma membrane.
    GO:0008625    extrinsic apoptotic signaling pathway via death domain receptors    A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0008630    intrinsic apoptotic signaling pathway in response to DNA damage    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0050728    negative regulation of inflammatory response    Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:2000304    positive regulation of ceramide biosynthetic process    Any process that activates or increases the frequency, rate or extent of ceramide biosynthetic process.
    GO:0050729    positive regulation of inflammatory response    Any process that activates or increases the frequency, rate or extent of the inflammatory response.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006693    prostaglandin metabolic process    The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:1903140    regulation of establishment of endothelial barrier    Any process that modulates the frequency, rate or extent of establishment of endothelial barrier.
    GO:0010803    regulation of tumor necrosis factor-mediated signaling pathway    Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0000139    Golgi membrane    The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ncf)
 
  Sites
(no "Sites" information available for 1ncf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ncf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ncf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNR1A_HUMAN | P19438
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  142680
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TNR1A_HUMAN | P19438
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNR1A_HUMAN | P194381ext 1ft4 1ich 1tnr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NCF)