1N7G - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE GDP-MANNOSE 4,6-DEHYDRATASE TERNARY COMPLEX WITH NADPH AND GDP-RHAMNOSE.

Authors :   A. M. Mulichak, C. P. Bonin, W. -D. Reiter, R. M. Garavito

Date :   14 Nov 02 (Deposition) - 07 Jan 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Rossmann Fold, Sdr, Short-Chain Dehydrogenase/Reductase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. M. Mulichak, C. P. Bonin, W. -D. Reiter, R. M. Garavito
The Structure Of The Mur1 Gdp-Mannose 4, 6-Dehydratase From A. Thaliana: Implications For Ligand Binding And Specificity.
Biochemistry V. 41 15557 2002
PubMed-ID: 12501186 | Reference-DOI: 10.1021/BI0266683
(for further references see the PDB file header)

Molecule 1 - GDP-D-MANNOSE-4,6-DEHYDRATASE
	Chains	:	A, B, C, D
	EC Number	:	4.2.1.47
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET28B
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	MUR1
	Organism Common	:	THALE CRESS
	Organism Scientific	:	ARABIDOPSIS THALIANA
	Organism Taxid	:	3702

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 7)

No.	Name	Count	Type	Full Name
1	GDR	3	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE-RHAMNOSE
2	NDP	4	Ligand/Ion	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:35 , THR A:37 , GLY A:38 , GLN A:39 , ASP A:40 , ARG A:60 , ASP A:91 , LEU A:92 , LEU A:113 , ALA A:114 , ALA A:115 , SER A:117 , TYR A:128 , VAL A:132 , ALA A:160 , GLY A:161 , SER A:162 , TYR A:185 , LYS A:189 , LEU A:212 , ASN A:214 , HIS A:215 , ARG A:220 , GDR A:801 , HOH A:806 , HOH A:807 , HOH A:810 , HOH A:820 , HOH A:825 , HOH A:837 , HOH A:838 , HOH A:839 , HOH A:847 , HOH A:851 , HOH A:929 , HOH A:931 , ARG C:61 , SER C:62 , SER C:63	BINDING SITE FOR RESIDUE NDP A 701
2	AC2	SOFTWARE	GDR A:802 , HOH A:862 , GLY B:35 , THR B:37 , GLY B:38 , GLN B:39 , ASP B:40 , ARG B:60 , ASP B:91 , LEU B:92 , LEU B:113 , ALA B:114 , ALA B:115 , SER B:117 , TYR B:128 , VAL B:132 , ALA B:160 , GLY B:161 , SER B:162 , TYR B:185 , LYS B:189 , LEU B:212 , ASN B:214 , HIS B:215 , ARG B:220 , HOH B:705 , HOH B:706 , HOH B:719 , HOH B:721 , HOH B:725 , HOH B:728 , HOH B:733 , HOH B:743 , HOH B:760 , HOH B:778 , ARG D:61 , SER D:62 , SER D:63	BINDING SITE FOR RESIDUE NDP B 702
3	AC3	SOFTWARE	ARG A:61 , SER A:62 , SER A:63 , GDR A:803 , HOH A:854 , GLY C:35 , THR C:37 , GLY C:38 , GLN C:39 , ASP C:40 , ARG C:60 , ASP C:91 , LEU C:92 , LEU C:113 , ALA C:114 , ALA C:115 , SER C:117 , TYR C:128 , VAL C:132 , ALA C:160 , GLY C:161 , SER C:162 , TYR C:185 , LYS C:189 , LEU C:212 , ASN C:214 , HIS C:215 , ARG C:220 , HOH C:704 , HOH C:719 , HOH C:723 , HOH C:724 , HOH C:726 , HOH C:731 , HOH C:737 , HOH C:747 , HOH C:748 , HOH C:749	BINDING SITE FOR RESIDUE NDP C 703
4	AC4	SOFTWARE	ARG B:61 , SER B:62 , SER B:63 , GLY D:35 , THR D:37 , GLY D:38 , GLN D:39 , ASP D:40 , ARG D:60 , ASP D:91 , LEU D:92 , LEU D:113 , ALA D:114 , ALA D:115 , SER D:117 , TYR D:128 , VAL D:132 , ALA D:160 , GLY D:161 , SER D:162 , TYR D:185 , LYS D:189 , LEU D:212 , ASN D:214 , HIS D:215 , ARG D:220 , HOH D:708 , HOH D:709 , HOH D:712 , HOH D:719 , HOH D:720 , HOH D:721 , HOH D:731 , HOH D:769 , HOH D:779 , HOH D:780 , HOH D:795 , HOH D:800	BINDING SITE FOR RESIDUE NDP D 704
5	AC5	SOFTWARE	SER A:117 , HIS A:118 , VAL A:119 , SER A:162 , SER A:163 , GLU A:164 , TYR A:185 , ASN A:214 , ARG A:220 , ASN A:223 , PHE A:224 , VAL A:225 , LYS A:228 , GLY A:247 , ASN A:248 , ALA A:251 , ARG A:253 , VAL A:287 , TYR A:312 , ARG A:314 , GLU A:317 , NDP A:701 , HOH A:822 , HOH A:823 , HOH A:828 , HOH A:832 , HOH A:867 , HOH A:922 , HOH A:931	BINDING SITE FOR RESIDUE GDR A 801
6	AC6	SOFTWARE	HOH A:858 , HOH A:862 , SER B:117 , HIS B:118 , VAL B:119 , SER B:162 , SER B:163 , GLU B:164 , TYR B:185 , ASN B:214 , ARG B:220 , ASN B:223 , PHE B:224 , VAL B:225 , LYS B:228 , LEU B:246 , GLY B:247 , ASN B:248 , ALA B:251 , ARG B:253 , VAL B:287 , TYR B:312 , ARG B:314 , GLU B:317 , NDP B:702 , HOH B:737 , HOH B:748 , HOH B:751 , HOH B:752	BINDING SITE FOR RESIDUE GDR A 802
7	AC7	SOFTWARE	HOH A:854 , HOH A:880 , HOH A:916 , SER C:117 , HIS C:118 , VAL C:119 , SER C:162 , SER C:163 , GLU C:164 , TYR C:185 , ASN C:214 , ARG C:220 , ASN C:223 , PHE C:224 , VAL C:225 , LYS C:228 , LEU C:246 , GLY C:247 , ASN C:248 , ALA C:251 , ARG C:253 , VAL C:287 , TYR C:312 , ARG C:314 , GLU C:317 , NDP C:703 , HOH C:722 , HOH C:735 , HOH C:786 , HOH C:830	BINDING SITE FOR RESIDUE GDR A 803

(no "SS Bond" information available for 1N7G)

Asymmetric/Biological Unit

No.	Residues
1	Pro A:171	-	Pro A:172
2	Pro B:171	-	Pro B:172
3	Pro C:171	-	Pro C:172
4	Pro D:171	-	Pro D:172

(no "SAP(SNP)/Variant" information available for 1N7G)

(no "PROSITE Motif" information available for 1N7G)

(no "Exon" information available for 1N7G)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:333
 aligned with GMD2_ARATH | P93031 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:340
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367
           GMD2_ARATH    28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYIDPHNVNKALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYM 367
               SCOP domains d1n7ga_ A: GDP-mannose 4,6-dehydratase                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1n7gA02 A:28-220,A:255-283,A:321-337 NAD(P)-bin       ding Rossmann-like Domain                                                                                                                  1n7gA01                           1n7gA02                      1n7gA01 A:221-254,A:284-320,A:338-3671n7gA02          1n7gA01                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhh...eeeeee...............-------...eeeee....hhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh...............hhhhhhhhhhhhhhhhhhhhhh.eeeeeee..ee.......hhhhhhhhhhhhhhh.....eee.....ee..eehhhhhhhhhhhh......eeee.....eehhhhhhhhhhhh..hhhh.eee.hhhh...........hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n7g A  28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIY-------KALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYM 367
                                    37        47        57        67      |  -    |   87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367
                                                                         74      82

Chain B from PDB  Type:PROTEIN  Length:336
 aligned with GMD2_ARATH | P93031 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:341
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367 
           GMD2_ARATH    28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYIDPHNVNKALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYMD 368
               SCOP domains d1n7gb_ B: GDP-mannose 4,6-dehydratase                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1n7gB02 B:28-220,B:255-283,B:321-337 NAD(P)-bindi     ng Rossmann-like Domain                                                                                                                    1n7gB01                           1n7gB02                      1n7gB01 B:221-254,B:284-320,B:338-3671n7gB02          1n7gB01                       - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhh...eeeeee..........hhhhhh.-----...eeeee....hhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh...............hhhhhhhhhhhhhhhhhhhhhh.eeeeeee..ee.......hhhhhhhhhhhhhhh.....eee.....ee..eehhhhhhhhhhhhhh....eeee.....eehhhhhhhhhhhh..hhhh.eee.hhhh...........hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n7g B  28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYID-----KALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYMD 368
                                    37        47        57        67        |-    |   87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367 
                                                                           76    82

Chain C from PDB  Type:PROTEIN  Length:334
 aligned with GMD2_ARATH | P93031 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:340
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367
           GMD2_ARATH    28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYIDPHNVNKALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYM 367
               SCOP domains d1n7gc_ C: GDP-mannose 4,6-dehydratase                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1n7gC02 C:28-220,C:255-283,C:321-337 NAD(P)-bind      ing Rossmann-like Domain                                                                                                                   1n7gC01                           1n7gC02                      1n7gC01 C:221-254,C:284-320,C:338-3671n7gC02          1n7gC01                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhh...eeeeee..........hhhhhh------...eeeee....hhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhh................hhhhhhhhhhhhhhhhhhhhhh.eeeeeee..ee.......hhhhhhhhhhhhhhh.....eee.....ee..eehhhhhhhhhhhhhh....eeee.....eehhhhhhhhhhhh..hhhh.eee.hhhh...........hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n7g C  28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYI------KALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGYM 367
                                    37        47        57        67       | -    |   87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367
                                                                          75     82

Chain D from PDB  Type:PROTEIN  Length:313
 aligned with GMD2_ARATH | P93031 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:335
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357     
           GMD2_ARATH    28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYIDPHNVNKALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLV 362
               SCOP domains d1n7gd_ D: GDP-mannose 4,6-dehydratase                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1n7gD02 D:28-220,D:255-283,D:321-337 NAD(P)-bind        ing Rossmann-like Domain                                                                                                                 1n7gD01                           1n7gD02                      1n7gD01 D:221-254,D:284-32         0,1n7gD02          1n7gD01                   CATH domains
           Pfam domains (1) ---Epimerase-1n7gD01 D:31-280                                                                                                                                                                                                                                -----------------------------         -------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---Epimerase-1n7gD02 D:31-280                                                                                                                                                                                                                                -----------------------------         -------------------------------------------- Pfam domains (2)
           Pfam domains (3) ---Epimerase-1n7gD03 D:31-280                                                                                                                                                                                                                                -----------------------------         -------------------------------------------- Pfam domains (3)
           Pfam domains (4) ---Epimerase-1n7gD04 D:31-280                                                                                                                                                                                                                                -----------------------------         -------------------------------------------- Pfam domains (4)
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh..eeeeee..........hhhhhh--------.eeeee....hhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhh................hhhhhhhhhhhhhhhhhhhhhh.eeeeeee..ee.......hhhhhhhhhhhhhhh.......-----.....eehhhhhhhhhhhh......eeee......hhhhhhhhhhhhh..hhhhh....---------......hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n7g D  28 RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYI--------LMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLF-----ASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEID---------DNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLV 362
                                    37        47        57        67       | -      | 87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       | -   |   257       267       277       287       297       307 |       - |     327       337       347       357     
                                                                          75       84                                                                                                                                                              245   251                                                       309       319

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: GDP-mannose 4,6-dehydratase (5)

Thale cress (Arabidopsis thaliana) [TaxId: 3702] (2)

1a	d1n7ga_	A:
1b	d1n7gb_	B:
1c	d1n7gc_	C:
1d	d1n7gd_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Thale cress (Arabidopsis thaliana) (15)

1a	1n7gD02	D:28-220,D:255-283,D:321-337
1b	1n7gA02	A:28-220,A:255-283,A:321-337
1c	1n7gC02	C:28-220,C:255-283,C:321-337
1d	1n7gB02	B:28-220,B:255-283,B:321-337

Architecture: Alpha-Beta Complex (3881)

Topology: UDP-galactose 4-epimerase; domain 1 (99)

Homologous Superfamily: UDP-galactose 4-epimerase, domain 1 (99)

Thale cress (Arabidopsis thaliana) (6)

2a	1n7gA01	A:221-254,A:284-320,A:338-367
2b	1n7gB01	B:221-254,B:284-320,B:338-367
2c	1n7gC01	C:221-254,C:284-320,C:338-367
2d	1n7gD01	D:221-254,D:284-320,D:338-362

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: Epimerase (42)

Arabidopsis thaliana (Mouse-ear cress) (3)

1a	Epimerase-1n7gD01	D:31-280
1b	Epimerase-1n7gD02	D:31-280
1c	Epimerase-1n7gD03	D:31-280
1d	Epimerase-1n7gD04	D:31-280

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (GMD2_ARATH | P93031)

molecular function
	GO:0008446	GDP-mannose 4,6-dehydratase activity	Catalysis of the reaction: GDP-alpha-D-mannose = GDP-4-dehydro-6-deoxy-alpha-D-mannose + H(2)O.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0042351	'de novo' GDP-L-fucose biosynthetic process	The chemical reactions and pathways resulting in the formation of GDP-L-fucose from GDP-D-mannose via GDP-4-dehydro-6-deoxy-D-mannose, requiring the functions of GDP-mannose 4,6-dehydratase (EC:4.2.1.47) and GDP-L-fucose synthase (EC:1.1.1.271).
	GO:0019673	GDP-mannose metabolic process	The chemical reactions and pathways involving GDP-mannose, a substance composed of mannose in glycosidic linkage with guanosine diphosphate.
	GO:0009826	unidimensional cell growth	The process in which a cell irreversibly increases in size in one [spatial] dimension or along one axis, resulting in the morphogenesis of the cell.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GDR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:171 - Pro A:172	[ RasMol ]
		Pro B:171 - Pro B:172	[ RasMol ]
		Pro C:171 - Pro C:172	[ RasMol ]
		Pro D:171 - Pro D:172	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1n7g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GMD2_ARATH \| P93031
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.2.1.47
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GMD2_ARATH \| P93031
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GMD2_ARATH \| P93031	:	1n7h

(no "Related Entries Specified in the PDB File" available for 1N7G)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Sites (7, 7)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (2, 8)

Pfam Domains (1, 4)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File