|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1MU4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1MU4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1MU4) |
PROSITE Motifs (2, 4)
Asymmetric Unit (2, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1MU4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:86 aligned with CRH_BACSU | O06976 from UniProtKB/Swiss-Prot Length:85 Alignment length:86 85 10 20 30 40 50 60 70 80 | CRH_BACSU 1 MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEV- - SCOP domains d1mu4a_ A: Crh, catabolite repression HPr-like protein SCOP domains CATH domains 1mu4A00 A:1-86 [code=3.30.1340.10, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) PTS_HPR_DOM PDB: A:1-85 UniProt: 1-85 - PROSITE (1) PROSITE (2) --------------------------------------PTS_HPR_SER -------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------- Transcript 1mu4 A 1 MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVL 86 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:87 aligned with CRH_BACSU | O06976 from UniProtKB/Swiss-Prot Length:85 Alignment length:87 85 10 20 30 40 50 60 70 80 | CRH_BACSU 1 MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEV-- - SCOP domains d1mu4b_ B: Crh, catabolite repression HPr-like protein SCOP domains CATH domains 1mu4B00 B:1-87 [code=3.30.1340.10, no name defined] CATH domains Pfam domains (1) PTS-HPr-1mu4B01 B:1-84 --- Pfam domains (1) Pfam domains (2) PTS-HPr-1mu4B02 B:1-84 --- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) PTS_HPR_DOM PDB: B:1-85 UniProt: 1-85 -- PROSITE (1) PROSITE (2) --------------------------------------PTS_HPR_SER --------------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------- Transcript 1mu4 B 1 MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVLQ 87 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1MU4)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|