1LD7 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CO-CRYSTAL STRUCTURE OF HUMAN FARNESYLTRANSFERASE WITH FARNESYLDIPHOSPHATE AND INHIBITOR COMPOUND 66

Authors :   J. S. Taylor, K. L. Terry, L. S. Beese

Date :   08 Apr 02 (Deposition) - 19 Jun 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Alpha-Alpha Barrel, Inhibitor, Ftase, Pftase, Fpp, Caax, Ras, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. M. Bell, S. N. Gallicchio, M. Abrams, L. S. Beese, D. C. Beshore, H. Bhimnathwala, M. J. Bogusky, C. A. Buser, J. C. Culberson, J. Davide, M. Ellis-Hutchings, C. Fernandes, J. B. Gibbs, S. L. Graham, K. A. Hamilton, G. D. Hartman, D. C. Heimbrook, C. F. Homnick, H. E. Huber, J. R. Huff, K. Kassahun, K. S. Koblan, N. E. Kohl, R. B. Lobell, J. J. Lynch Jr. , R. Robinson, A. D. Rodrigues, J. S. Taylor, E. S. Walsh, T. M. Williams, C. B. Zartman
3-Aminopyrrolidinone Farnesyltransferase Inhibitors: Design Of Macrocyclic Compounds With Improved Pharmacokinetics And Excellent Cell Potency.
J. Med. Chem. V. 45 2388 2002
PubMed-ID: 12036349 | Reference-DOI: 10.1021/JM010531D
(for further references see the PDB file header)

Molecule 1 - PROTEIN FARNESYLTRANSFERASE ALPHA SUBUNIT
	Chains	:	A
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CAAX FARNESYLTRANSFERASE ALPHA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE ALPHA, FTASE-ALPHA

Molecule 2 - PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT
	Chains	:	B
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CAAX FARNESYLTRANSFERASE BETA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE BETA, FTASE-BETA

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (4, 4)

No.	Name	Count	Type	Full Name
1	FPP	1	Ligand/Ion	FARNESYL DIPHOSPHATE
2	SUC	1	Ligand/Ion	SUCROSE
3	U66	1	Ligand/Ion	(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIAZACYCLONOADECOSINE-9-CARBONITRILE
4	ZN	1	Ligand/Ion	ZINC ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:241 , GLY A:282 , GLN A:285 , ASP A:286 , HOH A:1517 , ALA B:730 , ARG B:731 , GLN B:733 , ASN B:734 , TRP B:735 , GLY B:737 , ASN B:769 , SER B:772 , HOH B:1129 , HOH B:1193 , HOH B:1286 , HOH B:1287	BINDING SITE FOR RESIDUE SUC B 938
2	AC2	SOFTWARE	ASP B:797 , CYS B:799 , HIS B:862 , U66 B:1003	BINDING SITE FOR RESIDUE ZN B 1001
3	AC3	SOFTWARE	LYS A:164 , TYR A:166 , HIS B:748 , GLY B:750 , TYR B:751 , CYS B:754 , ARG B:791 , LYS B:794 , TYR B:800 , TRP B:803 , U66 B:1003 , HOH B:1060 , HOH B:1062 , HOH B:1064 , HOH B:1070 , HOH B:1072 , HOH B:1104 , HOH B:1136	BINDING SITE FOR RESIDUE FPP B 1002
4	AC4	SOFTWARE	TYR A:166 , LEU B:596 , SER B:599 , TRP B:602 , TRP B:606 , ARG B:702 , ASP B:797 , CYS B:799 , TYR B:800 , TYR B:861 , HIS B:862 , ZN B:1001 , FPP B:1002 , HOH B:1199 , HOH B:1255	BINDING SITE FOR RESIDUE U66 B 1003

(no "SS Bond" information available for 1LD7)

(no "Cis Peptide Bond" information available for 1LD7)

(no "SAP(SNP)/Variant" information available for 1LD7)

Asymmetric/Biological Unit (1, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PFTA	PS51147	Protein prenyltransferases alpha subunit repeat profile.	FNTA_HUMAN	112-146 181-215 147-180 216-249 255-289	5	A:112-146 A:181-215 A:147-180 A:216-249 A:255-289

Asymmetric/Biological Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000302279	2a	ENSE00002156549	chr8:42911296-42911689	394	FNTA_HUMAN	1-67	67	1	A:55-67	13
1.4b	ENST00000302279	4b	ENSE00002201932	chr8:42914235-42914320	86	FNTA_HUMAN	67-96	30	1	A:67-96	30
1.5	ENST00000302279	5	ENSE00002175026	chr8:42919244-42919358	115	FNTA_HUMAN	96-134	39	1	A:96-134	39
1.6b	ENST00000302279	6b	ENSE00002167598	chr8:42924698-42924802	105	FNTA_HUMAN	134-169	36	1	A:134-169	36
1.8	ENST00000302279	8	ENSE00002186091	chr8:42927324-42927450	127	FNTA_HUMAN	169-211	43	1	A:169-211	43
1.9d	ENST00000302279	9d	ENSE00001191775	chr8:42932359-42932507	149	FNTA_HUMAN	212-261	50	1	A:212-261	50
1.9g	ENST00000302279	9g	ENSE00001127401	chr8:42938261-42938323	63	FNTA_HUMAN	261-282	22	1	A:261-282	22
1.10d	ENST00000302279	10d	ENSE00001127397	chr8:42939853-42940024	172	FNTA_HUMAN	282-339	58	1	A:282-339	58
1.11e	ENST00000302279	11e	ENSE00002179236	chr8:42940303-42940931	629	FNTA_HUMAN	340-379	40	1	A:340-367	28

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:313
 aligned with FNTA_HUMAN | P49354 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:313
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
           FNTA_HUMAN    55 FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH 367
               SCOP domains d1ld7a_ A: Protein farnesyltransferase alpha-subunit                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1ld7A00 A:55-367  [code=1.25.40.120, no name defined]                                                                                                                                                                                                                                                                     CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ld7A01 A:258-288         ------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ld7A02 A:258-288         ------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ld7A03 A:258-288         ------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ld7A04 A:258-288         ------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ld7A05 A:258-288         ------------------------------------------------------------------------------- Pfam domains (5)
         Sec.struct. author ..........hhhhhhhhh...............ee..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------PFTA  PDB: A:112-146               PFTA  PDB: A:147-180              PFTA  PDB: A:181-215               PFTA  PDB: A:216-249              -----PFTA  PDB: A:255-289               ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a    ----------------------------Exon 1.5  PDB: A:96-134 UniProt: 96-134----------------------------------Exon 1.8  PDB: A:169-211 UniProt: 169-211  Exon 1.9d  PDB: A:212-261 UniProt: 212-261        --------------------Exon 1.10d  PDB: A:282-339 UniProt: 282-339               Exon 1.11e  PDB: A:340-367   Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.4b  PDB: A:67-96       -------------------------------------Exon 1.6b  PDB: A:134-169           -------------------------------------------------------------------------------------------Exon 1.9g             ------------------------------------------------------------------------------------- Transcript 1 (2)
                 1ld7 A  55 FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH 367
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364

Chain B from PDB  Type:PROTEIN  Length:407
 aligned with FNTB_HUMAN | P49356 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:407
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       
           FNTB_HUMAN    17 PVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPVPGF 423
               SCOP domains d1ld7b_ B: Protein farnesyltransferase, beta-subunit                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1ld7B00 B:517-923  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                                                                                                   CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------Prenyltrans_2-1ld7B03 B:627-741                                                                                    ----------------------------------------------------------------------------------------Prenyltrans-1ld7B01 B:830-874                ------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Prenyltrans-1ld7B02 B:830-874                ------------------------------------------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh.eehhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..............hhhhhhhhhhhhhhh.........hhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhheeee..eeee....hhhhh..........hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ld7 B 517 PVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPVPGF 923
                                   526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.120, no name defined] (62)

Human (Homo sapiens) (14)

1ld7A00

A:55-367

Architecture: Alpha/alpha barrel (251)

Topology: Glycosyltransferase (233)

Homologous Superfamily: [code=1.50.10.20, no name defined] (105)

Human (Homo sapiens) (23)

1ld7B00

B:517-923

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 6_Hairpin (120)

Family: Prenyltrans (49)

Homo sapiens (Human) (7)

1a	Prenyltrans-1ld7B01	B:830-874
1b	Prenyltrans-1ld7B02	B:830-874

Family: Prenyltrans_2 (47)

Homo sapiens (Human) (5)

Prenyltrans_2-1ld7B03

B:627-741

Clan: no clan defined [family: PPTA] (36)

Family: PPTA (36)

Homo sapiens (Human) (5)

3a	PPTA-1ld7A01	A:258-288
3b	PPTA-1ld7A02	A:258-288
3c	PPTA-1ld7A03	A:258-288
3d	PPTA-1ld7A04	A:258-288
3e	PPTA-1ld7A05	A:258-288

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (FNTA_HUMAN | P49354)

molecular function
	GO:0004662	CAAX-protein geranylgeranyltransferase activity	Catalysis of the reaction: geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. This reaction is the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. The protein substrates have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine and A2 should not be aromatic. Known substrates include most g-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families.
	GO:0004663	Rab geranylgeranyltransferase activity	Catalysis of the reaction: 2 geranylgeranyl diphosphate + protein-cysteine = 2 S-geranylgeranyl-protein + 2 diphosphate. This reaction is the formation of two thioether linkages between the C-1 atom of the geranylgeranyl groups and two cysteine residues within the terminal sequence motifs XXCC, XCXC or CCXX. Known substrates include Ras-related GTPases of a single family and the Rab family.
	GO:0030548	acetylcholine receptor regulator activity	Interacting (directly or indirectly) with acetylcholine receptors such that the proportion of receptors in the active form is changed.
	GO:0043014	alpha-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein alpha-tubulin.
	GO:0008017	microtubule binding	Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004660	protein farnesyltransferase activity	Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
	GO:0004661	protein geranylgeranyltransferase activity	Catalysis of the covalent addition of a geranylgeranyl (20-carbon isoprenoid) group via thioether linkages to a cysteine residue at or near the C terminus of a protein.
	GO:0008318	protein prenyltransferase activity	Catalysis of the covalent addition of an isoprenoid group such as a farnesyl or geranylgeranyl group via thioether linkages to a cysteine residue in a protein.
	GO:0030971	receptor tyrosine kinase binding	Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006921	cellular component disassembly involved in execution phase of apoptosis	The breakdown of structures such as organelles, proteins, or other macromolecular structures during apoptosis.
	GO:0007528	neuromuscular junction development	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
	GO:0045213	neurotransmitter receptor metabolic process	The chemical reactions and pathways involving neurotransmitter receptors.
	GO:0090045	positive regulation of deacetylase activity	Any process that activates or increases the frequency, rate or extent of deacetylase activity, the catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule.
	GO:0090044	positive regulation of tubulin deacetylation	Any process that increases the frequency, rate or extent of tubulin deacetylation. Tubulin deacetylation is the removal of an acetyl group from a protein amino acid.
	GO:0018343	protein farnesylation	The covalent attachment of a farnesyl group to a protein.
	GO:0018344	protein geranylgeranylation	The covalent attachment of a geranylgeranyl group to a protein.
	GO:0018342	protein prenylation	The covalent attachment of a prenyl group to a protein; geranyl, farnesyl, or geranylgeranyl groups may be added.
	GO:0099601	regulation of neurotransmitter receptor activity	Any process that modulates the frequency, rate or extent of neurotransmitter receptor activity. Modulation may be via an effect on ligand affinity, or effector funtion such as ion selectivity or pore opening/closing in ionotropic receptors.
	GO:0010469	regulation of receptor activity	Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0022400	regulation of rhodopsin mediated signaling pathway	Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
	GO:0071340	skeletal muscle acetylcholine-gated channel clustering	The accumulation of acetylcholine-gated cation channels in a narrow, central region of muscle fibers, in apposition to nerve terminals.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0005953	CAAX-protein geranylgeranyltransferase complex	A heterodimeric enzyme, composed of an alpha and a beta subunit. Participates in the post-translational C-terminal modification of several small GTPases, allowing their targeting to the membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005875	microtubule associated complex	Any multimeric complex connected to a microtubule.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005965	protein farnesyltransferase complex	A protein complex that possesses protein farnesyltransferase activity.

Chain B (FNTB_HUMAN | P49356)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0004311	farnesyltranstransferase activity	Catalysis of the reaction: 2-trans,6-trans-farnesyl diphosphate + isopentenyl diphosphate = diphosphate + geranylgeranyl diphosphate.
	GO:0019840	isoprenoid binding	Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0042277	peptide binding	Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004660	protein farnesyltransferase activity	Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0045787	positive regulation of cell cycle	Any process that activates or increases the rate or extent of progression through the cell cycle.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0048146	positive regulation of fibroblast proliferation	Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
	GO:0018343	protein farnesylation	The covalent attachment of a farnesyl group to a protein.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0022400	regulation of rhodopsin mediated signaling pathway	Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0010035	response to inorganic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005875	microtubule associated complex	Any multimeric complex connected to a microtubule.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0005965	protein farnesyltransferase complex	A protein complex that possesses protein farnesyltransferase activity.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FPP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SUC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		U66	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ld7)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ld7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FNTA_HUMAN \| P49354
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FNTB_HUMAN \| P49356
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FNTA_HUMAN \| P49354
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FNTB_HUMAN \| P49356
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1jcq	HUMAN FARNESYLTRANSFERASE WITH INHIBITOR COMPOUND L-739,750
1ld8	HUMAN FARNESYLTRANSFERASE WITH INHIBITOR COMPOUND 49

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 5)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (3, 8)

Gene Ontology (49, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File