Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CO-CRYSTAL STRUCTURE OF HUMAN FARNESYLTRANSFERASE WITH FARNESYLDIPHOSPHATE AND INHIBITOR COMPOUND 49
 
Authors :  J. S. Taylor, K. L. Terry, L. S. Beese
Date :  08 Apr 02  (Deposition) - 19 Jun 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Alpha Barrel, Inhibitor, Ftase, Pftase, Fpp, Caax, Ras, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. M. Bell, S. N. Gallicchio, M. Abrams, L. S. Beese, D. C. Beshore, H. Bhimnathwala, M. J. Bogusky, C. A. Buser, J. C. Culberson, J. Davide, M. Ellis-Hutchings, C. Fernandes, J. B. Gibbs, S. L. Graham, K. A. Hamilton, G. D. Hartman, D. C. Heimbrook, C. F. Homnick, H. E. Huber, J. R. Huff, K. Kassahun, K. S. Koblan, N. E. Kohl, R. B. Lobell, J. J. Lynch Jr. , R. Robinson, A. D. Rodrigues, J. S. Taylor, E. S. Walsh, T. M. Williams, C. B. Zartman
3-Aminopyrrolidinone Farnesyltransferase Inhibitors: Design Of Macrocyclic Compounds With Improved Pharmacokinetics And Excellent Cell Potency.
J. Med. Chem. V. 45 2388 2002
PubMed-ID: 12036349  |  Reference-DOI: 10.1021/JM010531D
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN FARNESYLTRANSFERASE ALPHA SUBUNIT
    ChainsA
    EC Number2.5.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCAAX FARNESYLTRANSFERASE ALPHA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE ALPHA, FTASE-ALPHA
 
Molecule 2 - PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT
    ChainsB
    EC Number2.5.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCAAX FARNESYLTRANSFERASE BETA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE BETA, FTASE-BETA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 6)

Asymmetric/Biological Unit (5, 6)
No.NameCountTypeFull Name
1ACY2Ligand/IonACETIC ACID
2FPP1Ligand/IonFARNESYL DIPHOSPHATE
3SUC1Ligand/IonSUCROSE
4U491Ligand/Ion(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE
5ZN1Ligand/IonZINC ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:241 , GLY A:282 , GLN A:285 , ASP A:286 , ALA B:730 , ARG B:731 , GLN B:733 , ASN B:734 , TRP B:735 , GLY B:737 , ASN B:769 , SER B:772 , HOH B:1117 , HOH B:1136 , HOH B:1173 , HOH B:1311BINDING SITE FOR RESIDUE SUC B 938
2AC2SOFTWAREASP B:797 , CYS B:799 , TYR B:861 , HIS B:862 , U49 B:1003BINDING SITE FOR RESIDUE ZN B 1001
3AC3SOFTWARELYS A:164 , TYR A:166 , ARG B:702 , HIS B:748 , GLY B:750 , TYR B:751 , CYS B:754 , ARG B:791 , LYS B:794 , TYR B:800 , TRP B:803 , U49 B:1003 , HOH B:1261 , HOH B:1262 , HOH B:1263 , HOH B:1265 , HOH B:1270 , HOH B:1272 , HOH B:1318BINDING SITE FOR RESIDUE FPP B 1002
4AC4SOFTWARETYR A:166 , ACY A:904 , LEU B:596 , SER B:599 , TRP B:602 , TRP B:606 , ARG B:702 , ASP B:797 , CYS B:799 , TYR B:800 , TYR B:861 , HIS B:862 , ZN B:1001 , FPP B:1002 , HOH B:1291BINDING SITE FOR RESIDUE U49 B 1003
5AC5SOFTWARELYS A:164 , TYR A:166 , HIS A:201 , HOH A:1970 , HOH A:2061 , U49 B:1003 , HOH B:1318BINDING SITE FOR RESIDUE ACY A 904
6AC6SOFTWAREGLN A:167 , HOH A:1908 , HOH A:2059 , HOH B:1271BINDING SITE FOR RESIDUE ACY A 905

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1LD8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1LD8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1LD8)

(-) PROSITE Motifs  (1, 5)

Asymmetric/Biological Unit (1, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PFTAPS51147 Protein prenyltransferases alpha subunit repeat profile.FNTA_HUMAN112-146
181-215
147-180
216-249
255-289
  5A:112-146
A:181-215
A:147-180
A:216-249
A:255-289

(-) Exons   (9, 9)

Asymmetric/Biological Unit (9, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000003022792aENSE00002156549chr8:42911296-42911689394FNTA_HUMAN1-67671A:55-6713
1.4bENST000003022794bENSE00002201932chr8:42914235-4291432086FNTA_HUMAN67-96301A:67-9630
1.5ENST000003022795ENSE00002175026chr8:42919244-42919358115FNTA_HUMAN96-134391A:96-13439
1.6bENST000003022796bENSE00002167598chr8:42924698-42924802105FNTA_HUMAN134-169361A:134-16936
1.8ENST000003022798ENSE00002186091chr8:42927324-42927450127FNTA_HUMAN169-211431A:169-21143
1.9dENST000003022799dENSE00001191775chr8:42932359-42932507149FNTA_HUMAN212-261501A:212-26150
1.9gENST000003022799gENSE00001127401chr8:42938261-4293832363FNTA_HUMAN261-282221A:261-28222
1.10dENST0000030227910dENSE00001127397chr8:42939853-42940024172FNTA_HUMAN282-339581A:282-33958
1.11eENST0000030227911eENSE00002179236chr8:42940303-42940931629FNTA_HUMAN340-379401A:340-36728

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:313
 aligned with FNTA_HUMAN | P49354 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:313
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
           FNTA_HUMAN    55 FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH 367
               SCOP domains d1ld8a_ A: Protein farnesyltransferase alpha-subunit                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1ld8A00 A:55-367  [code=1.25.40.120, no name defined]                                                                                                                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhh...............ee..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------PFTA  PDB: A:112-146               PFTA  PDB: A:147-180              PFTA  PDB: A:181-215               PFTA  PDB: A:216-249              -----PFTA  PDB: A:255-289               ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a    ----------------------------Exon 1.5  PDB: A:96-134 UniProt: 96-134----------------------------------Exon 1.8  PDB: A:169-211 UniProt: 169-211  Exon 1.9d  PDB: A:212-261 UniProt: 212-261        --------------------Exon 1.10d  PDB: A:282-339 UniProt: 282-339               Exon 1.11e  PDB: A:340-367   Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.4b  PDB: A:67-96       -------------------------------------Exon 1.6b  PDB: A:134-169           -------------------------------------------------------------------------------------------Exon 1.9g             ------------------------------------------------------------------------------------- Transcript 1 (2)
                 1ld8 A  55 FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH 367
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   

Chain B from PDB  Type:PROTEIN  Length:407
 aligned with FNTB_HUMAN | P49356 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:407
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       
           FNTB_HUMAN    17 PVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPVPGF 423
               SCOP domains d1ld8b_ B: Protein farnesyltransferase, beta-subunit                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1ld8B00 B:517-923  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh.eehhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh.........hhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhheeee..eeee....hhhhh..........hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ld8 B 517 PVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPVPGF 923
                                   526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1LD8)

(-) Gene Ontology  (49, 58)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FNTA_HUMAN | P49354)
molecular function
    GO:0004662    CAAX-protein geranylgeranyltransferase activity    Catalysis of the reaction: geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. This reaction is the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. The protein substrates have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine and A2 should not be aromatic. Known substrates include most g-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families.
    GO:0004663    Rab geranylgeranyltransferase activity    Catalysis of the reaction: 2 geranylgeranyl diphosphate + protein-cysteine = 2 S-geranylgeranyl-protein + 2 diphosphate. This reaction is the formation of two thioether linkages between the C-1 atom of the geranylgeranyl groups and two cysteine residues within the terminal sequence motifs XXCC, XCXC or CCXX. Known substrates include Ras-related GTPases of a single family and the Rab family.
    GO:0030548    acetylcholine receptor regulator activity    Interacting (directly or indirectly) with acetylcholine receptors such that the proportion of receptors in the active form is changed.
    GO:0043014    alpha-tubulin binding    Interacting selectively and non-covalently with the microtubule constituent protein alpha-tubulin.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0004659    prenyltransferase activity    Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004660    protein farnesyltransferase activity    Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
    GO:0004661    protein geranylgeranyltransferase activity    Catalysis of the covalent addition of a geranylgeranyl (20-carbon isoprenoid) group via thioether linkages to a cysteine residue at or near the C terminus of a protein.
    GO:0008318    protein prenyltransferase activity    Catalysis of the covalent addition of an isoprenoid group such as a farnesyl or geranylgeranyl group via thioether linkages to a cysteine residue in a protein.
    GO:0030971    receptor tyrosine kinase binding    Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006921    cellular component disassembly involved in execution phase of apoptosis    The breakdown of structures such as organelles, proteins, or other macromolecular structures during apoptosis.
    GO:0007528    neuromuscular junction development    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
    GO:0045213    neurotransmitter receptor metabolic process    The chemical reactions and pathways involving neurotransmitter receptors.
    GO:0090045    positive regulation of deacetylase activity    Any process that activates or increases the frequency, rate or extent of deacetylase activity, the catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule.
    GO:0090044    positive regulation of tubulin deacetylation    Any process that increases the frequency, rate or extent of tubulin deacetylation. Tubulin deacetylation is the removal of an acetyl group from a protein amino acid.
    GO:0018343    protein farnesylation    The covalent attachment of a farnesyl group to a protein.
    GO:0018344    protein geranylgeranylation    The covalent attachment of a geranylgeranyl group to a protein.
    GO:0018342    protein prenylation    The covalent attachment of a prenyl group to a protein; geranyl, farnesyl, or geranylgeranyl groups may be added.
    GO:0099601    regulation of neurotransmitter receptor activity    Any process that modulates the frequency, rate or extent of neurotransmitter receptor activity. Modulation may be via an effect on ligand affinity, or effector funtion such as ion selectivity or pore opening/closing in ionotropic receptors.
    GO:0010469    regulation of receptor activity    Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0022400    regulation of rhodopsin mediated signaling pathway    Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
    GO:0071340    skeletal muscle acetylcholine-gated channel clustering    The accumulation of acetylcholine-gated cation channels in a narrow, central region of muscle fibers, in apposition to nerve terminals.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005953    CAAX-protein geranylgeranyltransferase complex    A heterodimeric enzyme, composed of an alpha and a beta subunit. Participates in the post-translational C-terminal modification of several small GTPases, allowing their targeting to the membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005875    microtubule associated complex    Any multimeric complex connected to a microtubule.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005965    protein farnesyltransferase complex    A protein complex that possesses protein farnesyltransferase activity.

Chain B   (FNTB_HUMAN | P49356)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0004311    farnesyltranstransferase activity    Catalysis of the reaction: 2-trans,6-trans-farnesyl diphosphate + isopentenyl diphosphate = diphosphate + geranylgeranyl diphosphate.
    GO:0019840    isoprenoid binding    Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0004659    prenyltransferase activity    Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004660    protein farnesyltransferase activity    Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0045787    positive regulation of cell cycle    Any process that activates or increases the rate or extent of progression through the cell cycle.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0048146    positive regulation of fibroblast proliferation    Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0051770    positive regulation of nitric-oxide synthase biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
    GO:0018343    protein farnesylation    The covalent attachment of a farnesyl group to a protein.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0022400    regulation of rhodopsin mediated signaling pathway    Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
    GO:0034097    response to cytokine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0010035    response to inorganic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005875    microtubule associated complex    Any multimeric complex connected to a microtubule.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0005965    protein farnesyltransferase complex    A protein complex that possesses protein farnesyltransferase activity.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FPP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    U49  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ld8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ld8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FNTA_HUMAN | P49354
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FNTB_HUMAN | P49356
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FNTA_HUMAN | P49354
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FNTB_HUMAN | P49356
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FNTA_HUMAN | P493541jcq 1ld7 1mzc 1s63 1sa4 1tn6 2f0y 2h6f 2h6g 2h6h 2h6i 2iej 3e37
        FNTB_HUMAN | P493561jcq 1ld7 1mzc 1s63 1sa4 1tn6 2f0y 2h6f 2h6g 2h6h 2h6i 2iej 3e37

(-) Related Entries Specified in the PDB File

1jcq HUMAN FARNESYLTRANSFERASE WITH FPP AND INHIBITOR COMPOUND L -739,750
1ld7 HUMAN FARNESYLTRANSFERASE WITH FPP AND INHIBITOR COMPOUND 66