|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1KLL) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1KLL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1KLL) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1KLL) |
Exons (0, 0)| (no "Exon" information available for 1KLL) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:128 aligned with O05205_STRLA | O05205 from UniProtKB/TrEMBL Length:130 Alignment length:128 12 22 32 42 52 62 72 82 92 102 112 122 O05205_STRLA 3 ARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLP 130 SCOP domains d1klla_ A: Mitomycin resistance protein D, MRD SCOP domains CATH domains 1kllA00 A:3-130 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 CATH domains Pfam domains -Glyoxalase-1kllA01 A:4-125 ----- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 1kll A 3 ARISLFAVVVEDmAKSmEFYRKmGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLP 130 12 | | 22 | 32 42 52 62 72 82 92 102 112 122 15-MSE | 19-MSE | 25-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1KLL)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|