|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1KBA) |
Sites (0, 0)| (no "Site" information available for 1KBA) |
SS Bonds (10, 10)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1KBA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1KBA) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1KBA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot Length:87 Alignment length:66 31 41 51 61 71 81 3LKB_BUNMU 22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87 SCOP domains d1kbaa_ A: Bungarotoxin SCOP domains CATH domains 1kbaA00 A:1-66 CD59 CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ------------------------------------------------------------------ Transcript 1kba A 1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot Length:87 Alignment length:66 31 41 51 61 71 81 3LKB_BUNMU 22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87 SCOP domains d1kbab_ B: Bungarotoxin SCOP domains CATH domains 1kbaB00 B:1-66 CD59 CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ------------------------------------------------------------------ Transcript 1kba B 1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1KBA) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (3LKB_BUNMU | P01398)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|