|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1K1C) |
Sites (0, 0)| (no "Site" information available for 1K1C) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1K1C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1K1C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1K1C) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1K1C) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:84 aligned with CRH_BACSU | O06976 from UniProtKB/Swiss-Prot Length:85 Alignment length:84 11 21 31 41 51 61 71 81 CRH_BACSU 2 VQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEV 85 SCOP domains d1k1ca_ A: Crh, catabolite repression HPr-like protein SCOP domains CATH domains 1k1cA00 A:2-85 [code=3.30.1340.10, no name defined] CATH domains Pfam domains PTS-HPr-1k1cA01 A:2-84 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------------------------PTS_HPR_SER ------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 1k1c A 2 VQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEV 85 11 21 31 41 51 61 71 81
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1K1C)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|