|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2PJF) |
Sites (0, 0)| (no "Site" information available for 2PJF) |
SS Bonds (6, 6)
NMR Structure
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PJF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PJF) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2PJF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with VM2RH_CALRH | P30403 from UniProtKB/Swiss-Prot Length:478 Alignment length:68 417 427 437 447 457 467 VM2RH_CALRH 408 GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYH 475 SCOP domains d2pjfa_ A: Kistrin (rhodostomin) SCOP domains CATH domains 2pjfA00 A:1-68 Echistatin CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------DISINTEGRIN_1 ---------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 2pjf A 1 GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYH 68 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2PJF) |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (VM2RH_CALRH | P30403)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|