2PD4 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HELICOBACTER PYLORI ENOYL-ACYL CARRIER PROTEIN REDUCTASE IN COMPLEX WITH HYDROXYDIPHENYL ETHER COMPOUNDS, TRICLOSAN AND DICLOSAN

Authors :   H. H. Lee, J. H. Moon, S. W. Suh

Date :   31 Mar 07 (Deposition) - 17 Apr 07 (Release) - 24 Jun 08 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Antibacterial Target, Helicobacter Pylori, Type Ii Fatty Acid Biosynthesis, Enoyl-Acp-Reductase, Fabi, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. H. Lee, J. H. Moon, S. W. Suh
Crystal Structure Of The Helicobacter Pylori Enoyl-Acyl Carrier Protein Reductase In Complex With Hydroxydiphenyl Ether Compounds, Triclosan And Diclosan
Proteins V. 69 691 2007
PubMed-ID: 17879346 | Reference-DOI: 10.1002/PROT.21586
(for further references see the PDB file header)

Molecule 1 - ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
	Chains	:	A, B, C, D
	EC Number	:	1.3.1.9
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-22B(+)
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	HELICOBACTER PYLORI
	Organism Taxid	:	210
	Synonym	:	ENOYL-ACYL CARRIER PROTEIN REDUCTASE, NADH- DEPENDENT ENOYL-ACP REDUCTASE

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 8)

No.	Name	Count	Type	Full Name
1	DCN	4	Ligand/Ion	DICLOSAN
2	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:13 , VAL A:14 , ALA A:15 , SER A:19 , ILE A:20 , LEU A:40 , LEU A:44 , LEU A:63 , ASP A:64 , VAL A:65 , SER A:91 , VAL A:92 , ALA A:93 , ILE A:118 , SER A:144 , LYS A:162 , ALA A:188 , GLY A:189 , PRO A:190 , ILE A:191 , THR A:193 , ALA A:195 , PHE A:202 , DCN A:2414 , HOH A:2434 , HOH A:2444	BINDING SITE FOR RESIDUE NAD A 1780
2	AC2	SOFTWARE	GLY B:13 , VAL B:14 , ALA B:15 , SER B:19 , ILE B:20 , LEU B:40 , LEU B:44 , LEU B:63 , ASP B:64 , VAL B:65 , SER B:91 , VAL B:92 , ALA B:93 , LEU B:143 , SER B:144 , TYR B:145 , LYS B:162 , GLY B:189 , PRO B:190 , ILE B:191 , THR B:193 , ALA B:195 , DCN B:3414 , HOH B:3415 , HOH B:3417 , HOH B:3443 , HOH B:3467	BINDING SITE FOR RESIDUE NAD B 2780
3	AC3	SOFTWARE	GLY C:13 , VAL C:14 , ALA C:15 , SER C:19 , ILE C:20 , LEU C:40 , LEU C:44 , LEU C:63 , ASP C:64 , VAL C:65 , SER C:91 , VAL C:92 , ALA C:93 , LEU C:143 , SER C:144 , TYR C:145 , LYS C:162 , ALA C:188 , GLY C:189 , PRO C:190 , ILE C:191 , THR C:193 , LEU C:194 , ALA C:195 , DCN C:4414 , HOH C:4428	BINDING SITE FOR RESIDUE NAD C 3780
4	AC4	SOFTWARE	GLY D:13 , ALA D:15 , SER D:19 , ILE D:20 , LEU D:40 , LEU D:44 , LEU D:63 , ASP D:64 , VAL D:65 , SER D:91 , VAL D:92 , ALA D:93 , ILE D:118 , LEU D:143 , SER D:144 , TYR D:145 , LYS D:162 , ALA D:188 , GLY D:189 , PRO D:190 , ILE D:191 , THR D:193 , LEU D:194 , ALA D:195 , PHE D:202 , DCN D:5414 , HOH D:5419 , HOH D:5424	BINDING SITE FOR RESIDUE NAD D 4780
5	AC5	SOFTWARE	ALA A:93 , ALA A:95 , LEU A:100 , TYR A:145 , TYR A:155 , MET A:158 , ALA A:195 , ILE A:199 , PHE A:202 , NAD A:1780	BINDING SITE FOR RESIDUE DCN A 2414
6	AC6	SOFTWARE	ALA B:93 , PHE B:94 , ALA B:95 , LEU B:100 , TYR B:145 , TYR B:155 , MET B:158 , ALA B:195 , ILE B:199 , PHE B:202 , NAD B:2780	BINDING SITE FOR RESIDUE DCN B 3414
7	AC7	SOFTWARE	ALA C:93 , PHE C:94 , ALA C:95 , LEU C:100 , TYR C:145 , TYR C:155 , MET C:158 , ALA C:195 , ILE C:199 , PHE C:202 , NAD C:3780	BINDING SITE FOR RESIDUE DCN C 4414
8	AC8	SOFTWARE	ALA D:93 , ALA D:95 , LEU D:100 , TYR D:145 , TYR D:155 , MET D:158 , ALA D:195 , ILE D:199 , PHE D:202 , NAD D:4780	BINDING SITE FOR RESIDUE DCN D 5414

(no "SS Bond" information available for 2PD4)

(no "Cis Peptide Bond" information available for 2PD4)

(no "SAP(SNP)/Variant" information available for 2PD4)

(no "PROSITE Motif" information available for 2PD4)

(no "Exon" information available for 2PD4)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:274
 aligned with FABI_HELPY | O24990 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:274
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    
           FABI_HELPY     2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
               SCOP domains d2pd4a_ A: Enoyl-ACP reductase                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2pd4A00 A:2-275 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee......hhhhhhhhhhhh...eeeeee....hhhhhhhhhhhh....eee....hhhhhhhhhhhhhhhh..eeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......hhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh.............hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pd4 A   2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Chain B from PDB  Type:PROTEIN  Length:274
 aligned with FABI_HELPY | O24990 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:274
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    
           FABI_HELPY     2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
               SCOP domains d2pd4b_ B: Enoyl-ACP reductase                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2pd4B00 B:2-275 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee......hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhhhhh..eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......hhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh.............hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pd4 B   2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Chain C from PDB  Type:PROTEIN  Length:274
 aligned with FABI_HELPY | O24990 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:274
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    
           FABI_HELPY     2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
               SCOP domains d2pd4c_ C: Enoyl-ACP reductase                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2pd4C00 C:2-275 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee......hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhhhhh..eeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......hhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh.............hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pd4 C   2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Chain D from PDB  Type:PROTEIN  Length:274
 aligned with FABI_HELPY | O24990 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:274
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    
           FABI_HELPY     2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
               SCOP domains d2pd4d_ D: Enoyl-ACP reductase                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2pd4D00 D:2-275 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                CATH domains
           Pfam domains (1) -----------adh_short_C2-2pd4D01 D:13-251                                                                                                                                                                                                                  ------------------------ Pfam domains (1)
           Pfam domains (2) -----------adh_short_C2-2pd4D02 D:13-251                                                                                                                                                                                                                  ------------------------ Pfam domains (2)
           Pfam domains (3) -----------adh_short_C2-2pd4D03 D:13-251                                                                                                                                                                                                                  ------------------------ Pfam domains (3)
           Pfam domains (4) -----------adh_short_C2-2pd4D04 D:13-251                                                                                                                                                                                                                  ------------------------ Pfam domains (4)
         Sec.struct. author ......eeeee......hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhhhhh..eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhh..hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh.............hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pd4 D   2 GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ 275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: Enoyl-ACP reductase (96)

Helicobacter pylori [TaxId: 210] (2)

1a	d2pd4a_	A:
1b	d2pd4b_	B:
1c	d2pd4c_	C:
1d	d2pd4d_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Helicobacter pylori. Organism_taxid: 210. (2)

1a	2pd4A00	A:2-275
1b	2pd4B00	B:2-275
1c	2pd4C00	C:2-275
1d	2pd4D00	D:2-275

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: adh_short_C2 (98)

Helicobacter pylori (Campylobacter pylori) (2)

1a	adh_short_C2-2pd4D01	D:13-251
1b	adh_short_C2-2pd4D02	D:13-251
1c	adh_short_C2-2pd4D03	D:13-251
1d	adh_short_C2-2pd4D04	D:13-251

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (FABI_HELPY | O24990)

molecular function
	GO:0004318	enoyl-[acyl-carrier-protein] reductase (NADH) activity	Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0030497	fatty acid elongation	The elongation of a fatty acid chain by the sequential addition of two-carbon units.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DCN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pd4)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2pd4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FABI_HELPY \| O24990
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.1.9
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FABI_HELPY \| O24990
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FABI_HELPY \| O24990	:	2pd3

2pd3	TRICLOSAN COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File