1JN6 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF FAB-ESTRADIOL COMPLEXES

Authors :   C. Monnet, F. Bettsworth, E. A. Stura, M. -H. Le Du, R. Menez, L. Derrien Justin, B. Gilquin, G. Sibai, N. Battail-Poirot, M. Jolivet, A. Menez M. Arnaud, F. Ducancel, J. B. Charbonnier

Date :   23 Jul 01 (Deposition) - 06 Feb 02 (Release) - 28 Jun 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym./Biol. Unit : A,B

Keywords :   Igg Fold, Antibody-Hapten Complex, Estradiol, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Monnet, F. Bettsworth, E. A. Stura, M. H. Du, R. Menez, L. Derrien, S. Zinn-Justin, B. Gilquin, G. Sibai, N. Battail-Poirot, M. Jolivet, A. Menez, M. Arnaud, F. Ducancel, J. B. Charbonnier
Highly Specific Anti-Estradiol Antibodies: Structural Characterisation And Binding Diversity.
J. Mol. Biol. V. 315 699 2002
PubMed-ID: 11812141 | Reference-DOI: 10.1006/JMBI.2001.5284

Molecule 1 - MONOCLONAL ANTI-ESTRADIOL 10G6D6 FAB LIGHT CHAIN
	Chains	:	A
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Other Details	:	ASCETIC FLUID
	Synonym	:	FAB 10G6 LIGHT CHAIN

Molecule 2 - MONOCLONAL ANTI-ESTRADIOL 10G6D6 FAB HEAVY CHAIN
	Chains	:	B
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Other Details	:	ASCETIC FLUID
	Synonym	:	FAB 10G6 HEAVY CHAIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1JN6)

(no "Site" information available for 1JN6)

Asymmetric/Biological Unit

No.	Residues
1	A:22	-	A:90
2	A:137	-	A:196
3	B:22	-	B:96
4	B:145	-	B:200

Asymmetric/Biological Unit

No.	Residues
1	Tyr A:143	-	Pro A:144
2	Phe B:151	-	Pro B:152
3	Glu B:153	-	Pro B:154
4	Trp B:193	-	Pro B:194

(no "SAP(SNP)/Variant" information available for 1JN6)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	LAC1_MOUSE	84-90	1	A:194-200

(no "Exon" information available for 1JN6)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:206
 aligned with LAC1_MOUSE | P01843 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:206
                                                                                     2                                                                                                                                                    
                                                                                    1|                                                  3                                                                                                 
                                     -         -         -         -         -      || -         -         -         -         -        |4        14        24        34        44        54        64        74        84        94      
           LAC1_MOUSE     - --------------------------------------------------------QP--------------------------------------------------KSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS 100
               SCOP domains d1jn6a1 A:1-108 Immunoglobulin light chain lambda variable domain, VL-lambda                                d1jn6a2 A:113-210 Immunoglobulin light chain lambda constant domain, CL-lambda                     SCOP domains
               CATH domains 1jn6A01 A:1-113 Immunoglobulins                                                                              1jn6A02 A:114-209 Immunoglobulins                                                               - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------C1-set-1jn6A01 A:122-208                                                               -- Pfam domains
         Sec.struct. author ........eee.....eeeeee.......hhhhh.eeeeee...eeeeee.............eeeeee..eeeeeee..hhhhheeeeeeee....eee...eeee.....eeeee..hhhhhh..eeeeeeeeeee.....eeeeee..eee...eee...eee...eeeeeeeeeeehhhhhhh..eeeeeee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ---------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jn6 A   1 QAVVTQESALTTSPGETVTLTCRSSSGAITTSHYANWIQEKPDHLFTGLISGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYICALWFSNQFIFGSGTKVTVKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS 210
                                    10        20        30        40        50        60        70        80        90       100       114       124       134       144       154       164       174       184       194       204      
                                                                                                                                     108|                                                                                                 
                                                                                                                                      113

Chain B from PDB  Type:PROTEIN  Length:214
 aligned with Q6PF95_MOUSE | Q6PF95 from UniProtKB/TrEMBL  Length:464

    Alignment length:218
                                                                                                                            118  119                                                                                                                  
                                    29        39        49        59        69        79        89        99       109        |-   |   125       135       145       155       165       175       185       195       205       215       225        
         Q6PF95_MOUSE    20 QVQLKQSGAELVRPGASVKLSCKASGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAFMQLSSLKSEDSAVYFCAYG----YDALYWGQGTPITVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPVVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP 233
               SCOP domains d1jn6b1 B:1-117 Immunoglobulin heavy chain variable domain, VH                                                       ----d1jn6b2 B:121-217 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                   SCOP domains
               CATH domains 1jn6B01 B:1-121 Immunoglobulins                                                                                           1jn6B02 B:122-216 Immunoglobulins                                                              - CATH domains
               Pfam domains -V-set-1jn6B02 B:2-117                                                                                               --------------C1-set-1jn6B01 B:131-212                                                          ----- Pfam domains
         Sec.struct. author ..eeee...ee......eeeeeeee..hhhhheeeeeee......eeeeeee....eeee.......eeeeee....eeeeee...hhhhheeeeeeeeee..eeeeee...eeee.----....eeeee..........eeeeeeeeeee.....eeee.hhh....eee...eee..eeeeeeeeeee.hhh....eeeeee.hhhh.eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jn6 B   1 EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARYTQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTV----TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP 217
                                    10        20        30        40        50        60        70        80        90       100       110      |  - |     129       139       149       159       169       179       189       199       209        
                                                                                                                                              117  121

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

House mouse (Mus musculus) (616)

1a	1jn6B01	B:1-121
1b	1jn6B02	B:122-216
1c	1jn6A01	A:1-113
1d	1jn6A02	A:114-209

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Ig (577)

Family: C1-set (338)

Mus musculus (Mouse) (118)

1a	C1-set-1jn6A01	A:122-208
1b	C1-set-1jn6B01	B:131-212

Family: V-set (144)

Mus musculus (Mouse) (63)

V-set-1jn6B02

B:2-117

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (LAC1_MOUSE | P01843)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
cellular component
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (Q6PF95_MOUSE | Q6PF95)

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jn6)

	Sites
(no "Sites" information available for 1jn6)

	Cis Peptide Bonds
		Glu B:153 - Pro B:154	[ RasMol ]
		Phe B:151 - Pro B:152	[ RasMol ]
		Trp B:193 - Pro B:194	[ RasMol ]
		Tyr A:143 - Pro A:144	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1jn6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LAC1_MOUSE \| P01843
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q6PF95_MOUSE \| Q6PF95
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LAC1_MOUSE \| P01843
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q6PF95_MOUSE \| Q6PF95
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LAC1_MOUSE \| P01843	:	1jnh
UniProtKB/TrEMBL
	Q6PF95_MOUSE \| Q6PF95	:	1ejo 1xgy 2a6k 2gsi

(no "Related Entries Specified in the PDB File" available for 1JN6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (4, 4)

CATH Domains (1, 4)

Pfam Domains (2, 3)

Gene Ontology (2, 2)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File