1JCN - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   BINARY COMPLEX OF HUMAN TYPE-I INOSINE MONOPHOSPHATE DEHYDROGENASE WITH 6-CL-IMP

Authors :   D. Risal, M. D. Strickler, B. M. Goldstein

Date :   11 Jun 01 (Deposition) - 17 Jun 03 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (4x)
Biol. Unit 2: B  (4x)
Biol. Unit 3: A,B  (4x)

Keywords :   Dehydrogenase, Impd, Impdh, Guanine Nucleotide Synthesis, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Risal, M. D. Strickler, B. M. Goldstein
Crystal Structure Of The Human Type I Inosine Monophosphate Dehydrogenase And Implications For Isoform Specificity
To Be Published
PubMed: search

Molecule 1 - INOSINE MONOPHOSPHATE DEHYDROGENASE I
	Chains	:	A, B
	EC Number	:	1.1.1.205
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PIMP1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	IMPDH1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IMPD, IMPDH, INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE 1
	Variant	:	TYPE I ISOZYME

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (4x)	:	A
Biological Unit 2 (4x)	:		B
Biological Unit 3 (4x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	CPR	2	Ligand/Ion	6-CHLOROPURINE RIBOSIDE, 5'-MONOPHOSPHATE

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	CPR	4	Ligand/Ion	6-CHLOROPURINE RIBOSIDE, 5'-MONOPHOSPHATE

Biological Unit 2 (1, 4)

No.	Name	Count	Type	Full Name
1	CPR	4	Ligand/Ion	6-CHLOROPURINE RIBOSIDE, 5'-MONOPHOSPHATE

Biological Unit 3 (1, 8)

No.	Name	Count	Type	Full Name
1	CPR	8	Ligand/Ion	6-CHLOROPURINE RIBOSIDE, 5'-MONOPHOSPHATE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:68 , ARG A:322 , GLY A:328 , SER A:329 , CYS A:331 , GLN A:334 , ASP A:364 , GLY A:365 , GLY A:366 , MET A:385 , GLY A:387 , SER A:388 , HOH A:676 , HOH A:698 , HOH A:734 , HOH A:748	BINDING SITE FOR RESIDUE CPR A 631
2	AC2	SOFTWARE	SER B:68 , MET B:70 , ARG B:322 , GLY B:328 , SER B:329 , CYS B:331 , GLN B:334 , ASP B:364 , GLY B:365 , GLY B:366 , MET B:385 , GLY B:387 , SER B:388 , HOH B:639 , HOH B:689 , HOH B:698 , HOH B:716 , HOH B:734	BINDING SITE FOR RESIDUE CPR B 631

(no "SS Bond" information available for 1JCN)

(no "Cis Peptide Bond" information available for 1JCN)

Asymmetric Unit (9, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065616	R	105	W	IMDH1_HUMAN	Disease (LCA11)	---	A/B	R	105	W
2	UniProt	VAR_065617	T	116	M	IMDH1_HUMAN	Disease (RP10)	---	A/B	T	116	M
3	UniProt	VAR_065618	N	198	K	IMDH1_HUMAN	Disease (LCA11)	---	A/B	N	198	K
4	UniProt	VAR_017031	R	224	P	IMDH1_HUMAN	Disease (RP10)	---	A/B	R	224	P
5	UniProt	VAR_017032	D	226	N	IMDH1_HUMAN	Disease (RP10)	---	A/B	D	226	N
6	UniProt	VAR_017033	V	268	I	IMDH1_HUMAN	Disease (RP10)	---	A/B	V	268	I
7	UniProt	VAR_065619	A	285	T	IMDH1_HUMAN	Polymorphism	---	A/B	A	285	T
8	UniProt	VAR_065620	G	324	D	IMDH1_HUMAN	Unclassified	---	A/B	G	324	D
9	UniProt	VAR_065621	H	372	P	IMDH1_HUMAN	Disease (RP10)	---	A/B	H	372	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (9, 36)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065616	R	105	W	IMDH1_HUMAN	Disease (LCA11)	---	A	R	105	W
2	UniProt	VAR_065617	T	116	M	IMDH1_HUMAN	Disease (RP10)	---	A	T	116	M
3	UniProt	VAR_065618	N	198	K	IMDH1_HUMAN	Disease (LCA11)	---	A	N	198	K
4	UniProt	VAR_017031	R	224	P	IMDH1_HUMAN	Disease (RP10)	---	A	R	224	P
5	UniProt	VAR_017032	D	226	N	IMDH1_HUMAN	Disease (RP10)	---	A	D	226	N
6	UniProt	VAR_017033	V	268	I	IMDH1_HUMAN	Disease (RP10)	---	A	V	268	I
7	UniProt	VAR_065619	A	285	T	IMDH1_HUMAN	Polymorphism	---	A	A	285	T
8	UniProt	VAR_065620	G	324	D	IMDH1_HUMAN	Unclassified	---	A	G	324	D
9	UniProt	VAR_065621	H	372	P	IMDH1_HUMAN	Disease (RP10)	---	A	H	372	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (9, 36)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065616	R	105	W	IMDH1_HUMAN	Disease (LCA11)	---	B	R	105	W
2	UniProt	VAR_065617	T	116	M	IMDH1_HUMAN	Disease (RP10)	---	B	T	116	M
3	UniProt	VAR_065618	N	198	K	IMDH1_HUMAN	Disease (LCA11)	---	B	N	198	K
4	UniProt	VAR_017031	R	224	P	IMDH1_HUMAN	Disease (RP10)	---	B	R	224	P
5	UniProt	VAR_017032	D	226	N	IMDH1_HUMAN	Disease (RP10)	---	B	D	226	N
6	UniProt	VAR_017033	V	268	I	IMDH1_HUMAN	Disease (RP10)	---	B	V	268	I
7	UniProt	VAR_065619	A	285	T	IMDH1_HUMAN	Polymorphism	---	B	A	285	T
8	UniProt	VAR_065620	G	324	D	IMDH1_HUMAN	Unclassified	---	B	G	324	D
9	UniProt	VAR_065621	H	372	P	IMDH1_HUMAN	Disease (RP10)	---	B	H	372	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (9, 72)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065616	R	105	W	IMDH1_HUMAN	Disease (LCA11)	---	A/B	R	105	W
2	UniProt	VAR_065617	T	116	M	IMDH1_HUMAN	Disease (RP10)	---	A/B	T	116	M
3	UniProt	VAR_065618	N	198	K	IMDH1_HUMAN	Disease (LCA11)	---	A/B	N	198	K
4	UniProt	VAR_017031	R	224	P	IMDH1_HUMAN	Disease (RP10)	---	A/B	R	224	P
5	UniProt	VAR_017032	D	226	N	IMDH1_HUMAN	Disease (RP10)	---	A/B	D	226	N
6	UniProt	VAR_017033	V	268	I	IMDH1_HUMAN	Disease (RP10)	---	A/B	V	268	I
7	UniProt	VAR_065619	A	285	T	IMDH1_HUMAN	Polymorphism	---	A/B	A	285	T
8	UniProt	VAR_065620	G	324	D	IMDH1_HUMAN	Unclassified	---	A/B	G	324	D
9	UniProt	VAR_065621	H	372	P	IMDH1_HUMAN	Disease (RP10)	---	A/B	H	372	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CBS	PS51371	CBS domain profile.	IMDH1_HUMAN	114-173 179-237	4	A:114-164 B:114-164 A:181-237 B:181-237
2	IMP_DH_GMP_RED	PS00487	IMP dehydrogenase / GMP reductase signature.	IMDH1_HUMAN	321-333	2	A:321-333 B:321-333

Biological Unit 1 (2, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CBS	PS51371	CBS domain profile.	IMDH1_HUMAN	114-173 179-237	8	A:114-164 - A:181-237 -
2	IMP_DH_GMP_RED	PS00487	IMP dehydrogenase / GMP reductase signature.	IMDH1_HUMAN	321-333	4	A:321-333 -

Biological Unit 2 (2, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CBS	PS51371	CBS domain profile.	IMDH1_HUMAN	114-173 179-237	8	- B:114-164 - B:181-237
2	IMP_DH_GMP_RED	PS00487	IMP dehydrogenase / GMP reductase signature.	IMDH1_HUMAN	321-333	4	- B:321-333

Biological Unit 3 (2, 24)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CBS	PS51371	CBS domain profile.	IMDH1_HUMAN	114-173 179-237	16	A:114-164 B:114-164 A:181-237 B:181-237
2	IMP_DH_GMP_RED	PS00487	IMP dehydrogenase / GMP reductase signature.	IMDH1_HUMAN	321-333	8	A:321-333 B:321-333

(no "Exon" information available for 1JCN)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:395
 aligned with IMDH1_HUMAN | P20839 from UniProtKB/Swiss-Prot  Length:514

    Alignment length:490
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499
          IMDH1_HUMAN    10 TGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI 499
               SCOP domains d1jcna1 A:10-111,A:232-499 Inosine monophosphate dehydrogenase (IMPDH)                                d1jcna4 A:11                 2-231         Type II in                osine monophosphate dehydrogenase CBS d    omains  d1jcna1 A:10-111,A:232-499 Inosine monophosphate dehydrogenase (IMPDH)                                                                                                                                                                                                       SCOP domains
               CATH domains 1jcnA00 A:10-499 Aldolase class I                                                                                                                                                                                                                                                                                                                                                                                                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh......hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhh.............-----------------.ee...--------..ee.hhhhh----------------.......ee.......hhhhhhhhh.....ee.......----.......................eeee....hhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee..................hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee.............--------------------------------------------------..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee....... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------W----------M---------------------------------------------------------------------------------K-------------------------P-N-----------------------------------------I----------------T--------------------------------------D-----------------------------------------------P------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------CBS  PDB: A:114-164 UniProt: 114-173                        -----CBS  PDB: A:181-237 UniProt: 179-237                       -----------------------------------------------------------------------------------IMP_DH_GMP_RE---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jcn A  10 TGYVPEDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSP-----------------GIPITE--------VGIVTSRDID----------------PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELV----RTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGE--------------------------------------------------KGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI 499
                                    19        29        39        49        59        69        79        89        99       109       119   |     -         - |    |  -     | 159    |    -         - |     189       199       209       219    |  229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399         -         -         -         -         -|      459       469       479       489       499
                                                                                                                                           123               141  146      155      164              181                                   219  224                                                                                                                                                                            399                                                450

Chain B from PDB  Type:PROTEIN  Length:395
 aligned with IMDH1_HUMAN | P20839 from UniProtKB/Swiss-Prot  Length:514

    Alignment length:490
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499
          IMDH1_HUMAN    10 TGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI 499
               SCOP domains d1jcnb1 B:10-111,B:232-499 Inosine monophosphate dehydrogenase (IMPDH)                                d1jcnb4 B:11                 2-231         Type II in                osine monophosphate dehydrogenase CBS d    omains  d1jcnb1 B:10-111,B:232-499 Inosine monophosphate dehydrogenase (IMPDH)                                                                                                                                                                                                       SCOP domains
               CATH domains 1jcnB00 B:10-499 Aldolase class I                                                                                                                                                                                                                                                                                                                                                                                                                                                                          CATH domains
           Pfam domains (1) ------------------IMPDH-1jcnB01 B:28-499                                                                                                                                                                                                                                                                                                                                                                                                                                                                   Pfam domains (1)
           Pfam domains (2) ------------------IMPDH-1jcnB02 B:28-499                                                                                                                                                                                                                                                                                                                                                                                                                                                                   Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------                 ------        ----------                CBS-1jcnB03 B:181-232                               -----------------------------------------------------------------------------------------------------------------------------------------------------------------------                                                  -------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------                 ------        ----------                CBS-1jcnB04 B:181-232                               -----------------------------------------------------------------------------------------------------------------------------------------------------------------------                                                  -------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------                 ------        ----------                CBS-1jcnB05 B:181-232                               -----------------------------------------------------------------------------------------------------------------------------------------------------------------------                                                  -------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------                 ------        ----------                CBS-1jcnB06 B:181-232                               -----------------------------------------------------------------------------------------------------------------------------------------------------------------------                                                  -------------------------------------------------- Pfam domains (6)
         Sec.struct. author .........hhhhhh......hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhh.............-----------------......--------.ee.hhhhhh----------------.......ee...hhhhhhhhhhhhh.....ee.......----.......................eeee....hhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh...eeee..................hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeeehhhhhh.......--------------------------------------------------..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee....... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------W----------M---------------------------------------------------------------------------------K-------------------------P-N-----------------------------------------I----------------T--------------------------------------D-----------------------------------------------P------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------CBS  PDB: B:114-164 UniProt: 114-173                        -----CBS  PDB: B:181-237 UniProt: 179-237                       -----------------------------------------------------------------------------------IMP_DH_GMP_RE---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jcn B  10 TGYVPEDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSP-----------------GIPITE--------VGIVTSRDID----------------PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELV----RTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGE--------------------------------------------------KGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI 499
                                    19        29        39        49        59        69        79        89        99       109       119   |     -         - |    |  -     | 159    |    -         - |     189       199       209       219    |  229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399         -         -         -         -         -|      459       469       479       489       499
                                                                                                                                           123               141  146      155      164              181                                   219  224                                                                                                                                                                            399                                                450

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: Aldolase class I (887)

Human (Homo sapiens) (78)

1a	1jcnA00	A:10-499
1b	1jcnB00	B:10-499

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TIM_barrel (694)

Family: IMPDH (16)

Homo sapiens (Human) (3)

1a	IMPDH-1jcnB01	B:28-499
1b	IMPDH-1jcnB02	B:28-499

Clan: no clan defined [family: CBS] (51)

Family: CBS (51)

Homo sapiens (Human) (7)

2a	CBS-1jcnB03	B:181-232
2b	CBS-1jcnB04	B:181-232
2c	CBS-1jcnB05	B:181-232
2d	CBS-1jcnB06	B:181-232

Asymmetric Unit(hide GO term definitions)

Chain A,B (IMDH1_HUMAN | P20839)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003938	IMP dehydrogenase activity	Catalysis of the reaction: inosine 5'-phosphate + NAD+ + H2O = xanthosine 5'-phosphate + NADH + H+.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006177	GMP biosynthetic process	The chemical reactions and pathways resulting in the formation of GMP, guanosine monophosphate.
	GO:0046651	lymphocyte proliferation	The expansion of a lymphocyte population by cell division.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0009168	purine ribonucleoside monophosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of purine ribonucleoside monophosphate, a compound consisting of a purine base linked to a ribose sugar esterified with phosphate on the sugar.
	GO:0009409	response to cold	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cold stimulus, a temperature stimulus below the optimal temperature for that organism.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CPR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jcn)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1jcn
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMDH1_HUMAN \| P20839
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.205
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	180105
		Disease Information	:	OMIM
	613837
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMDH1_HUMAN \| P20839
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1JCN)

(no "Related Entries Specified in the PDB File" available for 1JCN)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 18)

PROSITE Motifs (2, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (1, 2)

Pfam Domains (2, 6)

Gene Ontology (20, 20)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File