|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 10)
|
Asymmetric Unit (10, 10)
|
(no "SS Bond" information available for 1HZ5) |
(no "Cis Peptide Bond" information available for 1HZ5) |
(no "SAP(SNP)/Variant" information available for 1HZ5) |
(no "PROSITE Motif" information available for 1HZ5) |
(no "Exon" information available for 1HZ5) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:72 aligned with Q51912_FINMA | Q51912 from UniProtKB/TrEMBL Length:719 Alignment length:87 96 106 116 126 136 146 156 166 Q51912_FINMA 87 FDQSEHPFVENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG 173 SCOP domains d1hz5a _ A: Immunoglobulin light chain-binding domain of protein L SCOP domains CATH domains 1hz5A0 0 A:-7-64 [code=3.10.20.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1hz5 A -7 MHHHHH---------------HAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG 64 | - - | 7 17 27 37 47 57 -2 -1 Chain B from PDB Type:PROTEIN Length:72 aligned with Q51912_FINMA | Q51912 from UniProtKB/TrEMBL Length:719 Alignment length:87 96 106 116 126 136 146 156 166 Q51912_FINMA 87 FDQSEHPFVENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG 173 SCOP domains d1hz5b _ B: Immunoglobulin light chain-binding domain of protein L SCOP domains CATH domains 1hz5B0 0 B:-7-64 [code=3.10.20.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1hz5 B -7 MHHHHH---------------HAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG 64 | - - | 7 17 27 37 47 57 -2 -1
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1HZ5) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q51912_FINMA | Q51912)
|
|
|
|
|
|
|