|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 10)
Asymmetric Unit (1, 10)
|
Sites (10, 10)
Asymmetric Unit (10, 10)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1HZ5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HZ5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HZ5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1HZ5) |
Exons (0, 0)| (no "Exon" information available for 1HZ5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:72 aligned with Q51912_FINMA | Q51912 from UniProtKB/TrEMBL Length:719 Alignment length:87 96 106 116 126 136 146 156 166 Q51912_FINMA 87 FDQSEHPFVENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG 173 SCOP domains d1hz5a _ A: Immunoglobulin light chain-binding domain of protein L SCOP domains CATH domains 1hz5A0 0 A:-7-64 [code=3.10.20.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1hz5 A -7 MHHHHH---------------HAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG 64 | - - | 7 17 27 37 47 57 -2 -1 Chain B from PDB Type:PROTEIN Length:72 aligned with Q51912_FINMA | Q51912 from UniProtKB/TrEMBL Length:719 Alignment length:87 96 106 116 126 136 146 156 166 Q51912_FINMA 87 FDQSEHPFVENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG 173 SCOP domains d1hz5b _ B: Immunoglobulin light chain-binding domain of protein L SCOP domains CATH domains 1hz5B0 0 B:-7-64 [code=3.10.20.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1hz5 B -7 MHHHHH---------------HAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG 64 | - - | 7 17 27 37 47 57 -2 -1
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HZ5) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q51912_FINMA | Q51912)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|