![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 10) Biological Unit 1 (2, 7) Biological Unit 2 (1, 3) |
Asymmetric Unit (10, 10)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1H8U) |
Asymmetric Unit (3, 6)
|
Asymmetric Unit (2, 4)
|
Asymmetric Unit (4, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:115 aligned with PRG2_HUMAN | P13727 from UniProtKB/Swiss-Prot Length:222 Alignment length:115 117 127 137 147 157 167 177 187 197 207 217 PRG2_HUMAN 108 RYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY 222 SCOP domains d1h8ua_ A: Eosinophil major basic protein SCOP domains CATH domains 1h8uA00 A:3-117 Mannose-Binding Protein A, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) (1) -----------------------------------------------------------------------C--------------------------Y---------------- SAPs(SNPs) (1) SAPs(SNPs) (2) -----------------------------------------------------------------------C------------------------------------------- SAPs(SNPs) (2) PROSITE (1) -C_TYPE_LECTIN_2 PDB: A:4-116 UniProt: 109-221 - PROSITE (1) PROSITE (2) -----------------------------------------------------------------------------------------C_TYPE_LECTIN_1 -- PROSITE (2) Transcript 1 (1) Exon 1.3b Exon 1.3d PDB: A:18-61 UniProt: 123-166 Exon 1.4 PDB: A:62-99 ------------------ Transcript 1 (1) Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.5d Transcript 1 (2) 1h8u A 3 RYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY 117 12 22 32 42 52 62 72 82 92 102 112 Chain B from PDB Type:PROTEIN Length:116 aligned with PRG2_HUMAN | P13727 from UniProtKB/Swiss-Prot Length:222 Alignment length:116 116 126 136 146 156 166 176 186 196 206 216 PRG2_HUMAN 107 CRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY 222 SCOP domains d1h8ub_ B: Eosinophil major basic protein SCOP domains CATH domains 1h8uB00 B:2-117 Mannose-Binding Protein A, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) (1) ------------------------------------------------------------------------C--------------------------Y---------------- SAPs(SNPs) (1) SAPs(SNPs) (2) ------------------------------------------------------------------------C------------------------------------------- SAPs(SNPs) (2) PROSITE (1) --C_TYPE_LECTIN_2 PDB: B:4-116 UniProt: 109-221 - PROSITE (1) PROSITE (2) ------------------------------------------------------------------------------------------C_TYPE_LECTIN_1 -- PROSITE (2) Transcript 1 (1) Exon 1.3b Exon 1.3d PDB: B:18-61 UniProt: 123-166 Exon 1.4 PDB: B:62-99 ------------------ Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------------------------------------------------Exon 1.5d Transcript 1 (2) 1h8u B 2 CRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY 117 11 21 31 41 51 61 71 81 91 101 111
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1H8U) |
Asymmetric Unit(hide GO term definitions) Chain A,B (PRG2_HUMAN | P13727)
|
|
|
|
|
|
|