![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 4)
|
Asymmetric Unit (4, 4)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1H8P) |
Asymmetric Unit (2, 6)
|
(no "Exon" information available for 1H8P) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with SFP1_BOVIN | P02784 from UniProtKB/Swiss-Prot Length:134 Alignment length:88 56 66 76 86 96 106 116 126 SFP1_BOVIN 47 EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC 134 SCOP domains d1h8pa1 A:22-67 d1h8pa2 A:68-109 SCOP domains CATH domains 1h8pA01 A:22-61 ----1h8pA02 A:66-109 CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) FN2_2 PDB: - UniProt: 44-88 FN2_2 PDB: A:64-109 UniProt: 89-134 PROSITE (1) PROSITE (2) --FN2_1 PDB: A:24-61 UniProt: 49-86 -------FN2_1 PDB: A:69-109 UniProt: 94-134 PROSITE (2) Transcript ---------------------------------------------------------------------------------------- Transcript 1h8p A 22 EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC 109 31 41 51 61 71 81 91 101 Chain B from PDB Type:PROTEIN Length:88 aligned with SFP1_BOVIN | P02784 from UniProtKB/Swiss-Prot Length:134 Alignment length:88 56 66 76 86 96 106 116 126 SFP1_BOVIN 47 EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC 134 SCOP domains d1h8pb1 B:22-67 d1h8pb2 B:68-109 SCOP domains CATH domains 1h8pB01 B:22-61 ----1h8pB02 B:66-109 CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) FN2_2 PDB: - UniProt: 44-88 FN2_2 PDB: B:64-109 UniProt: 89-134 PROSITE (1) PROSITE (2) --FN2_1 PDB: B:24-61 UniProt: 49-86 -------FN2_1 PDB: B:69-109 UniProt: 94-134 PROSITE (2) Transcript ---------------------------------------------------------------------------------------- Transcript 1h8p B 22 EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC 109 31 41 51 61 71 81 91 101
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1H8P) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SFP1_BOVIN | P02784)
|
|
|
|
|
|
|